M2OR : Database of Olfactory Receptors-Molecule Measurments

Unique InChIKey

Unique Receptor Sequence

Unique Co-Receptor Sequence

EC50 Parameter

Unique DOI

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Orco	ref\|XP_081832551.1\|	100.00	Ips typographus	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...
	Orco	ref\|XP_081832551.1\|	99.79	Ips typographus	M1L	MEQKLISEEDLMNKFKVAGLVADLMPNIRL ...

Showing 1 to 30 of 701 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(Z)-2-Methyl-6-methylene-2,7-octadien-1-ol	17015-29-1	IEVYLQISZQFFGA-JXMROGBWSA-N	5319723	C/C(=C\CCC(=C)C=C)/CO	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-methylthioadenosine triphosphate tetrasodium	43170-89-4	XNOBOKJVOTYSJV-UHFFFAOYSA-N	1582	CSC1=NC(=C2C(=N1)N(C=N2)C3C(C(C(O3)COP(= ...	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	6,8-dioxabicyclo[3.2.1]octane, 1,5-dimethyl-	60478-96-8	AZWKCIZRVUVZPX-UHFFFAOYSA-N	34235	CC12CCCC(O1)(OC2)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Ipsdienol	35628-00-3	NHMKYUHMPXBMFI-SNVBAGLBSA-N	92301	CC(=C[C@H](CC(=C)C=C)O)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(4R)-2-methyl-6-methylideneocta-2,7-dien-4-ol	60894-97-5	NHMKYUHMPXBMFI-JTQLQIEISA-N	181296	CC(=C[C@@H](CC(=C)C=C)O)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(-)-4-terpineol	20126-76-5	WRYLYDPHFGVWKC-JTQLQIEISA-N	5325830	CC1=CC[C@](CC1)(C(C)C)O	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Camphor	76-22-2	DSSYKIVIOFKYAU-UHFFFAOYSA-N	2537	CC1(C2CCC1(C(=O)C2)C)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Pinocarvone, trans-(-)-	19890-00-7	TZDMGBLPGZXHJI-JGVFFNPUSA-N	12314319	CC1([C@H]2C[C@@H]1C(=C)C(=O)C2)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	trans-Pinocamphone (pinocamphone)	N.A.	MQPHVIPKLRXGDJ-BIIVOSGPSA-N	6430551	C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Pinocamphone	547-60-4	MQPHVIPKLRXGDJ-PRJMDXOYSA-N	6427105	C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Isopinocamphone	14575-93-0	MQPHVIPKLRXGDJ-RNJXMRFFSA-N	84532	C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Gamma-Terpinene	99-85-4	YKFLAYDHMOASIY-UHFFFAOYSA-N	7461	CC1=CCC(=CC1)C(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Verbenol, (S)-cis-	18881-04-04	WONIGEXYPVIKFS-YIZRAAEISA-N	87839	CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Bicyclo(3.1.1)hept-3-en-2-ol, 4,6,6-trimethyl-, (1R,2S,5R)-rel-	1820-09-03	WONIGEXYPVIKFS-VGMNWLOBSA-N	89664	CC1=C[C@@H]([C@@H]2C[C@H]1C2(C)C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Verbenol, (S)-trans-	19890-02-09	WONIGEXYPVIKFS-DJLDLDEBSA-N	88298	CC1=C[C@H]([C@H]2C[C@@H]1C2(C)C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Levoverbenone	1196-01-06	DCSCXTJOXBUFGB-JGVFFNPUSA-N	92874	CC1=CC(=O)[C@H]2C[C@@H]1C2(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-2,7-octadien-4-ol	14434-41-4	NHMKYUHMPXBMFI-UHFFFAOYSA-N	85734	CC(=CC(CC(=C)C=C)O)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	3,7-Octadien-2-ol, 2-methyl-6-methylene-, (E)-	6994-89-4	NOEQSPUVXRMJBW-SOFGYWHQSA-N	5363351	CC(C)(/C=C/CC(=C)C=C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	4-Thujanol	17699-16-0	KXSDPILWMGFJMM-AEJSXWLSSA-N	6326181	CC(C)[C@@]12CC[C@@]([C@@H]1C2)(C)O	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Grandisol	26532-22-9	SJKPJXGGNKMRPD-VHSXEESVSA-N	169202	CC(=C)[C@@H]1CC[C@]1(C)CCO	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	6,10-Dimethylundeca-5,9-Dien-2-One	689-67-8	HNZUNIKWNYHEJJ-UHFFFAOYSA-N	19633	CC(=CCCC(=CCCC(=O)C)C)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(1R,2R,5S)-2,6,6-trimethylbicyclo[3.1.1]heptan-3-one	473-62-1	MQPHVIPKLRXGDJ-GJMOJQLCSA-N	10329459	C[C@@H]1[C@H]2C[C@H](C2(C)C)CC1=O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	1,8-Cineole	470-82-6	WEEGYLXZBRQIMU-UHFFFAOYSA-N	2758	CC1(C2CCC(O1)(CC2)C)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Isophorone	78-59-1	HJOVHMDZYOCNQW-UHFFFAOYSA-N	6544	CC1=CC(=O)CC(C1)(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Lanierone	28750-52-9	GKOBUKITZSFCJC-UHFFFAOYSA-N	642486	CC1=CC(C=C(C1=O)O)(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-3-buten-2-ol	115-18-4	HNVRRHSXBLFLIG-UHFFFAOYSA-N	8257	CC(C)(C=C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	alpha-Pinene, (+)-	7785-70-8	GRWFGVWFFZKLTI-RKDXNWHRSA-N	82227	CC1=CC[C@@H]2C[C@H]1C2(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Myrcene	123-35-3	UAHWPYUMFXYFJY-UHFFFAOYSA-N	31253	CC(=CCCC(=C)C=C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	P-Cymene	99-87-6	HFPZCAJZSCWRBC-UHFFFAOYSA-N	7463	CC1=CC=C(C=C1)C(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.

« Previous
Next »

Showing 1 to 30 of 701 results