2-Methyl-6-methylene-7-octen-4-ol | M2iOR

2-Methyl-6-methylene-7-octen-4-ol

CID: 85712

InChIKey: RHAXCOKCIAVHPB-UHFFFAOYSA-N

SMILES: CC(C)CC(CC(=C)C=C)O

Mixture: Sum of Isomers

1

Unique InChIKey

6

Unique Receptor Sequence

1

Unique Co-Receptor Sequence

1

EC50 Parameter

2

Unique DOI

Showing 1 to 6 of 6 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Ips typographus	Or23	A0A8F3ERX1	-	MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or27	A0A8F3EVI2	-	MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or29	A0A8F3IVT0	K111E	MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or28	A0A8F3IXZ3	-	MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	0.13 %Δ fluorescence	Norm. other	30 µM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.