1
Unique InChIKey
13
Unique Receptor Sequence
2
Unique Co-Receptor Sequence
1
EC50 Parameter
4
Unique DOI
Results
Showing 1 to 23 of 23 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or23 | A0A8F3ERX1 | - | MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or27 | A0A8F3EVI2 | - | MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | Yes | Dose-Response | N.A. | EC50 | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.278 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Dendroctonus ponderosae | Or8 | ref|XP_048521609.1| | - | MGKPIPNPLLGLDSTIKQPSYEVYATDFFS ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 1.391 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Dendroctonus ponderosae | Or9 | ref|XP_019768310.1| | - | MGKPIPNPLLGLDSTDTLGPALTKVRLRLP ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.465 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Hylobius abietis | Or3 | UQK85193 | - | MFNRTYARDFFVVNRWMLMCAGLWRPETKN ... | Hylobius abietis | Orco | Not available | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.286 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Hylobius abietis | Or4 | gb|UQK85194.1| | I12T | MGKPIPNPLLGLDSTTFITGADNLQTESKN ... | Hylobius abietis | Orco | Not available | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -0.497 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.837 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or6 | XP_081832923 | - | MLRKNPRYATDFFSVNQWMLRRAGLWRPSN ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.181 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.537 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.867 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.71 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.432 % | Norm. receptor | 1.880e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.991 % | Norm. receptor | 2.340e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.1 % | Norm. receptor | 2.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.988 % | Norm. receptor | 3.750e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.373 % | Norm. receptor | 4.690e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.068 % | Norm. receptor | 5.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.012 % | Norm. receptor | 7.500e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.949 % | Norm. receptor | 9.380e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |