1
Unique InChIKey
5
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
1
EC50 Parameter
1
Unique DOI
Results
Showing 1 to 5 of 5 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or23 | A0A8F3ERX1 | - | MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-4-terpineol | 20126-76-5 | WRYLYDPHFGVWKC-JTQLQIEISA-N | 5325830 | CC1=CC[C@](CC1)(C(C)C)O | Monomolecular | Yes | Dose-Response | N.A. | EC50 | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-4-terpineol | 20126-76-5 | WRYLYDPHFGVWKC-JTQLQIEISA-N | 5325830 | CC1=CC[C@](CC1)(C(C)C)O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or27 | A0A8F3EVI2 | - | MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-4-terpineol | 20126-76-5 | WRYLYDPHFGVWKC-JTQLQIEISA-N | 5325830 | CC1=CC[C@](CC1)(C(C)C)O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-4-terpineol | 20126-76-5 | WRYLYDPHFGVWKC-JTQLQIEISA-N | 5325830 | CC1=CC[C@](CC1)(C(C)C)O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-4-terpineol | 20126-76-5 | WRYLYDPHFGVWKC-JTQLQIEISA-N | 5325830 | CC1=CC[C@](CC1)(C(C)C)O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |