84
Unique InChIKey
14
Unique Receptor Sequence
2
Unique Co-Receptor Sequence
37
EC50 Parameter
4
Unique DOI
BLAST (Receptor variants)
| Orco | ref|XP_081832551.1| | 100.00 | Ips typographus | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | |
| Orco | ref|XP_081832551.1| | 99.79 | Ips typographus | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Results
Showing 211 to 240 of 701 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Ethanol | 64-17-5 | LFQSCWFLJHTTHZ-UHFFFAOYSA-N | 702 | CCO | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane | 68108-90-7 | XNNASGSBOJGKAZ-IUCAKERBSA-N | 155085 | C[C@H]1CCC[C@]2(O1)CCCO2 | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Phenylethanol | 1960-12-08 | WRMNZCZEMHIOCP-UHFFFAOYSA-N | 6054 | C1=CC=C(C=C1)CCO | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Styrene | 100-42-5 | PPBRXRYQALVLMV-UHFFFAOYSA-N | 7501 | C=CC1=CC=CC=C1 | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 4-Methoxystyrene | 637-69-4 | UAJRSHJHFRVGMG-UHFFFAOYSA-N | 12507 | COC1=CC=C(C=C1)C=C | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Estragole | 140-67-0 | ZFMSMUAANRJZFM-UHFFFAOYSA-N | 8815 | COC1=CC=C(C=C1)CC=C | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 3,4-Dimethoxytoluene | 494-99-5 | GYPMBQZAVBFUIZ-UHFFFAOYSA-N | 68126 | CC1=CC(=C(C=C1)OC)OC | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Methyleugenol | 93-15-2 | ZYEMGPIYFIJGTP-UHFFFAOYSA-N | 7127 | COC1=C(C=C(C=C1)CC=C)OC | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 4-Ethylguaiacol | 2785-89-9 | CHWNEIVBYREQRF-UHFFFAOYSA-N | 62465 | CCC1=CC(=C(C=C1)O)OC | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | Yes | Primary | 13.425 %Δ fluorescence | Norm. other | 50 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Verbenol, (S)-cis- | 18881-04-04 | WONIGEXYPVIKFS-YIZRAAEISA-N | 87839 | CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O | Monomolecular | No | Primary | -0.346 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Verbenol, (S)-trans- | 19890-02-09 | WONIGEXYPVIKFS-DJLDLDEBSA-N | 88298 | CC1=C[C@H]([C@H]2C[C@@H]1C2(C)C)O | Monomolecular | No | Primary | -0.56 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Levoverbenone | 1196-01-06 | DCSCXTJOXBUFGB-JGVFFNPUSA-N | 92874 | CC1=CC(=O)[C@H]2C[C@@H]1C2(C)C | Monomolecular | No | Primary | -0.019 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Methyl-6-methylene-2,7-octadien-4-ol | 14434-41-4 | NHMKYUHMPXBMFI-UHFFFAOYSA-N | 85734 | CC(=CC(CC(=C)C=C)O)C | Sum of Isomers | No | Primary | -0.165 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Methyl-6-methylene-7-octen-4-ol | 14314-21-7 | RHAXCOKCIAVHPB-UHFFFAOYSA-N | 85712 | CC(C)CC(CC(=C)C=C)O | Sum of Isomers | No | Primary | 0.13 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 3,7-Octadien-2-ol, 2-methyl-6-methylene-, (E)- | 6994-89-4 | NOEQSPUVXRMJBW-SOFGYWHQSA-N | 5363351 | CC(C)(/C=C/CC(=C)C=C)O | Monomolecular | No | Primary | -0.139 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (Z)-2-Methyl-6-methylene-2,7-octadien-1-ol | 17015-29-1 | IEVYLQISZQFFGA-JXMROGBWSA-N | 5319723 | C/C(=C\CCC(=C)C=C)/CO | Monomolecular | No | Primary | -0.479 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+-)-Myrtenol | 515-00-4 | RXBQNMWIQKOSCS-UHFFFAOYSA-N | 10582 | CC1(C2CC=C(C1C2)CO)C | Sum of Isomers | No | Primary | 0.543 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Methyl-3-buten-2-ol | 115-18-4 | HNVRRHSXBLFLIG-UHFFFAOYSA-N | 8257 | CC(C)(C=C)O | Monomolecular | No | Primary | -0.083 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Lanierone | 28750-52-9 | GKOBUKITZSFCJC-UHFFFAOYSA-N | 642486 | CC1=CC(C=C(C1=O)O)(C)C | Monomolecular | Yes | Primary | 32.787 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 6,8-dioxabicyclo[3.2.1]octane, 1,5-dimethyl- | 60478-96-8 | AZWKCIZRVUVZPX-UHFFFAOYSA-N | 34235 | CC12CCCC(O1)(OC2)C | Sum of Isomers | No | Primary | -0.076 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Brevicomin | 20290-99-7 | YONXEBYXWVCXIV-HLTSFMKQSA-N | 181255 | CC[C@@H]1[C@H]2CCC[C@](O2)(O1)C | Monomolecular | No | Primary | -0.125 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Chalcogran | 38401-84-2 | DCWKALWZHORJAO-UHFFFAOYSA-N | 581383 | CCC1CCC2(O1)CCCO2 | Sum of Isomers | No | Primary | 0.474 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane | 68108-90-7 | XNNASGSBOJGKAZ-IUCAKERBSA-N | 155085 | C[C@H]1CCC[C@]2(O1)CCCO2 | Monomolecular | No | Primary | 0.061 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Camphor | 76-22-2 | DSSYKIVIOFKYAU-UHFFFAOYSA-N | 2537 | CC1(C2CCC1(C(=O)C2)C)C | Sum of Isomers | No | Primary | -0.384 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.278 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | trans-Pinocamphone (pinocamphone) | N.A. | MQPHVIPKLRXGDJ-BIIVOSGPSA-N | 6430551 | C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.538 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (1R,2R,5S)-2,6,6-trimethylbicyclo[3.1.1]heptan-3-one | 473-62-1 | MQPHVIPKLRXGDJ-GJMOJQLCSA-N | 10329459 | C[C@@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 1.381 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 1.582 %Δ fluorescence | Norm. other | 30 µM | 9 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | N.A. |