64
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
| Or5 | XP_081828105 | 100.00 | Ips typographus | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... |
Results
Showing 1 to 30 of 75 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | No | Primary | -0.944 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (1R,2R,5S)-2,6,6-trimethylbicyclo[3.1.1]heptan-3-one | 473-62-1 | MQPHVIPKLRXGDJ-GJMOJQLCSA-N | 10329459 | C[C@@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.184 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | trans-Pinocamphone (pinocamphone) | N.A. | MQPHVIPKLRXGDJ-BIIVOSGPSA-N | 6430551 | C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 1.33 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 4-Thujanol | 17699-16-0 | KXSDPILWMGFJMM-AEJSXWLSSA-N | 6326181 | CC(C)[C@@]12CC[C@@]([C@@H]1C2)(C)O | Monomolecular | No | Primary | -0.051 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Bicyclo(3.1.1)hept-3-en-2-ol, 4,6,6-trimethyl-, (1R,2S,5R)-rel- | 1820-09-03 | WONIGEXYPVIKFS-VGMNWLOBSA-N | 89664 | CC1=C[C@@H]([C@@H]2C[C@H]1C2(C)C)O | Monomolecular | No | Primary | -2.204 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | alpha-Pinene, (+)- | 7785-70-8 | GRWFGVWFFZKLTI-RKDXNWHRSA-N | 82227 | CC1=CC[C@@H]2C[C@H]1C2(C)C | Monomolecular | No | Primary | 0.495 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 1.183 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.837 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Levoverbenone | 1196-01-06 | DCSCXTJOXBUFGB-JGVFFNPUSA-N | 92874 | CC1=CC(=O)[C@H]2C[C@@H]1C2(C)C | Monomolecular | No | Primary | 0.225 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Verbenol, (S)-trans- | 19890-02-09 | WONIGEXYPVIKFS-DJLDLDEBSA-N | 88298 | CC1=C[C@H]([C@H]2C[C@@H]1C2(C)C)O | Monomolecular | No | Primary | -0.573 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-alpha-Pinene | 7785-26-4 | GRWFGVWFFZKLTI-IUCAKERBSA-N | 440968 | CC1=CC[C@H]2C[C@@H]1C2(C)C | Monomolecular | No | Primary | 0.095 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Verbenol, (S)-cis- | 18881-04-04 | WONIGEXYPVIKFS-YIZRAAEISA-N | 87839 | CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O | Monomolecular | No | Primary | 1.334 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane | 68108-90-7 | XNNASGSBOJGKAZ-IUCAKERBSA-N | 155085 | C[C@H]1CCC[C@]2(O1)CCCO2 | Monomolecular | No | Primary | 0.518 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 1-Octen-3-Ol | 3391-86-4 | VSMOENVRRABVKN-UHFFFAOYSA-N | 18827 | CCCCCC(C=C)O | Sum of Isomers | No | Primary | -1.54 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Methylbutyl Acetate | 624-41-9 | XHIUFYZDQBSEMF-UHFFFAOYSA-N | 12209 | CCC(C)COC(=O)C | Sum of Isomers | No | Primary | 1.289 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 3-Octanol | 589-98-0 | NMRPBPVERJPACX-UHFFFAOYSA-N | 11527 | CCCCCC(CC)O | Sum of Isomers | No | Primary | 1.829 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Camphene | 79-92-5 | CRPUJAZIXJMDBK-UHFFFAOYSA-N | 6616 | CC1(C2CCC(C2)C1=C)C | Sum of Isomers | No | Primary | 0.558 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Camphor | 76-22-2 | DSSYKIVIOFKYAU-UHFFFAOYSA-N | 2537 | CC1(C2CCC1(C(=O)C2)C)C | Sum of Isomers | No | Primary | 1.303 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Carvone, (+-)- | 99-49-0 | ULDHMXUKGWMISQ-UHFFFAOYSA-N | 7439 | CC1=CCC(CC1=O)C(=C)C | Sum of Isomers | No | Primary | -0.059 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-Frontalin | 28401-39-0 | AZWKCIZRVUVZPX-JGVFFNPUSA-N | 10888022 | C[C@@]12CCC[C@@](O1)(OC2)C | Monomolecular | No | Primary | -0.239 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Cyclobutaneethanol, 1-methyl-2-(1-methylethenyl)-, (1R,2S)-rel- | 30820-22-5 | SJKPJXGGNKMRPD-UHFFFAOYSA-N | 117314 | CC(=C)C1CCC1(C)CCO | Sum of Isomers | No | Primary | 0.951 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Methyl-6-methylene-2,7-octadien-4-ol | 14434-41-4 | NHMKYUHMPXBMFI-UHFFFAOYSA-N | 85734 | CC(=CC(CC(=C)C=C)O)C | Sum of Isomers | No | Primary | 0.095 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (-)-Ipsenol | 35628-05-8 | RHAXCOKCIAVHPB-JTQLQIEISA-N | 93186 | CC(C)C[C@@H](CC(=C)C=C)O | Monomolecular | No | Primary | 0.264 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+-)-Myrtenol | 515-00-4 | RXBQNMWIQKOSCS-UHFFFAOYSA-N | 10582 | CC1(C2CC=C(C1C2)CO)C | Sum of Isomers | No | Primary | -1.123 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Sabinene | 3387-41-5 | NDVASEGYNIMXJL-UHFFFAOYSA-N | 18818 | CC(C)C12CCC(=C)C1C2 | Sum of Isomers | No | Primary | -0.145 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (1R,5S,7S)-7-ethyl-5-methyl-6,8-dioxabicyclo[3.2.1]octane | 22625-19-0 | YONXEBYXWVCXIV-YIZRAAEISA-N | 182344 | CC[C@H]1[C@H]2CCC[C@](O2)(O1)C | Monomolecular | No | Primary | -0.234 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Brevicomin | 20290-99-7 | YONXEBYXWVCXIV-HLTSFMKQSA-N | 181255 | CC[C@@H]1[C@H]2CCC[C@](O2)(O1)C | Monomolecular | No | Primary | 0.977 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 1,8-Cineole | 470-82-6 | WEEGYLXZBRQIMU-UHFFFAOYSA-N | 2758 | CC1(C2CCC(O1)(CC2)C)C | Sum of Isomers | No | Primary | 0.994 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Primary | 1.804 % | Norm. receptor | 3.000e-5 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |
| Ips typographus | Or5 | XP_081828105 | - | MLNHDYPKNVLSSVDTILLICGLGKISKKI ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Methyl-3-buten-2-ol | 115-18-4 | HNVRRHSXBLFLIG-UHFFFAOYSA-N | 8257 | CC(C)(C=C)O | Monomolecular | No | Primary | 0.695 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | N.A. |