1
Unique InChIKey
5
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
Results
Showing 1 to 5 of 5 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or46 | A0A7L8XZ66 | - | MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
3,7-Dimethylocta-2,6-Dienal
cis,trans-Citral |
N.A. | WTEVQBCEXWBHNA-UHFFFAOYSA-N | 8843 | CC(=CCCC(=CC=O)C)C | Sum of Isomers | No | Primary | < 3 % | Norm. receptor | 30 µM | 9 | Calcium Imaging | FLUOstar Omega plate reader | ∆ Fluorescence | Hek | TREx/HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Roberts, R. E. ... | 10.1186/s12915-020-00946-6 | Supplementary Data 2 |
| Ips typographus | Or49 | A0A7L8XYT4 | - | MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
3,7-Dimethylocta-2,6-Dienal
cis,trans-Citral |
N.A. | WTEVQBCEXWBHNA-UHFFFAOYSA-N | 8843 | CC(=CCCC(=CC=O)C)C | Sum of Isomers | No | Primary | < 3 % | Norm. receptor | 30 µM | 9 | Calcium Imaging | FLUOstar Omega plate reader | ∆ Fluorescence | Hek | TREx/HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Roberts, R. E. ... | 10.1186/s12915-020-00946-6 | Supplementary Data 2 |
| Ips typographus | Or46 | A0A7L8XZ66 | Y84F | MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
3,7-Dimethylocta-2,6-Dienal
cis,trans-Citral |
N.A. | WTEVQBCEXWBHNA-UHFFFAOYSA-N | 8843 | CC(=CCCC(=CC=O)C)C | Sum of Isomers | No | Primary | < 3 % | Norm. receptor | 30 µM | 9 | Calcium Imaging | FLUOstar Omega plate reader | ∆ Fluorescence | Hek | TREx/HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Roberts, R. E. ... | 10.1186/s12915-020-00946-6 | Supplementary Data 2 |
| Ips typographus | Or46 | A0A7L8XZ66 | Y84A | MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
3,7-Dimethylocta-2,6-Dienal
cis,trans-Citral |
N.A. | WTEVQBCEXWBHNA-UHFFFAOYSA-N | 8843 | CC(=CCCC(=CC=O)C)C | Sum of Isomers | No | Primary | < 3 % | Norm. receptor | 30 µM | 9 | Calcium Imaging | FLUOstar Omega plate reader | ∆ Fluorescence | Hek | TREx/HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Roberts, R. E. ... | 10.1186/s12915-020-00946-6 | Supplementary Data 2 |
| Ips typographus | Or46 | A0A7L8XZ66 | T205A | MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
3,7-Dimethylocta-2,6-Dienal
cis,trans-Citral |
N.A. | WTEVQBCEXWBHNA-UHFFFAOYSA-N | 8843 | CC(=CCCC(=CC=O)C)C | Sum of Isomers | No | Primary | < 3 % | Norm. receptor | 30 µM | 9 | Calcium Imaging | FLUOstar Omega plate reader | ∆ Fluorescence | Hek | TREx/HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Roberts, R. E. ... | 10.1186/s12915-020-00946-6 | Supplementary Data 2 |