761
Unique InChIKey
337
Unique Receptor Sequence
23
Unique Co-Receptor Sequence
1113
EC50 Parameter
41
Unique DOI
Results
Showing 35131 to 35160 of 35891 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 116.467 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Dose-Response | 6.6 Spikes/s | Raw | 1.000e-4 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Dose-Response | 11.4 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 19.4 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 44.6 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 90.4 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 115.2 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 121.667 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | Yes | Dose-Response | 11.6 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | Yes | Dose-Response | 36.4 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | Yes | Dose-Response | 65.6 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | Yes | Dose-Response | 97.667 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | No | Dose-Response | 4 Spikes/s | Raw | 1.000e-4 µg | 1 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | No | Dose-Response | 4 Spikes/s | Raw | 0.001 µg | 1 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | No | Dose-Response | 2 Spikes/s | Raw | 1.000e-4 µg | 1 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | No | Dose-Response | 6 Spikes/s | Raw | 0.001 µg | 3 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Heptanol
1-Heptanol |
111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | No | Dose-Response | 7 Spikes/s | Raw | 0.1 µg | 1 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | No | Dose-Response | 6 Spikes/s | Raw | 1.000e-4 µg | 3 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Dose-Response | 11 Spikes/s | Raw | 1.000e-4 µg | 1 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Dose-Response | 8 Spikes/s | Raw | 0.001 µg | 1 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Dose-Response | 4.333 Spikes/s | Raw | 0.01 µg | 3 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Salicylate | 119-36-8 | OSWPMRLSEDHDFF-UHFFFAOYSA-N | 4133 | COC(=O)C1=CC=CC=C1O | Monomolecular | Yes | Secondary | 17.9 Spikes/s | Raw | 0.1 µg | 10 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Humulene
α-humulene |
6753-98-6 | FAMPSKZZVDUYOS-HRGUGZIWSA-N | 5281520 | C/C/1=C\CC(/C=C/C/C(=C/CC1)/C)(C)C | Monomolecular | No | Primary | 4.4 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
(-)-Caryophyllene
β-caryophyllene |
87-44-5 | NPNUFJAVOOONJE-GFUGXAQUSA-N | 5281515 | C/C/1=C\CCC(=C)[C@H]2CC([C@@H]2CC1)(C)C | Monomolecular | No | Primary | 6.6 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Carene | 13466-78-9 | BQOFWKZOCNGFEC-UHFFFAOYSA-N | 26049 | CC1=CCC2C(C1)C2(C)C | Sum of Isomers | No | Primary | 5.2 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Copaene
α-copaene |
3856-25-5 | VLXDPFLIRFYIME-BTFPBAQTSA-N | 12303902 | CC1=CC[C@H]2[C@H]3[C@@H]1[C@@]2(CC[C@H]3 ... | Monomolecular | No | Primary | 7.4 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Farnesene
(E,E)-α-farnesene |
502-61-4 | CXENHBSYCFFKJS-VDQVFBMKSA-N | 5281516 | CC(=CCC/C(=C/C/C=C(\C)/C=C)/C)C | Monomolecular | No | Primary | 8.4 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
(+-)-alpha-Pinene
α-pinene |
80-56-8 | GRWFGVWFFZKLTI-UHFFFAOYSA-N | 6654 | CC1=CCC2CC1C2(C)C | Sum of Isomers | No | Primary | 4.4 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Beta-Pinene
β-pinene |
127-91-3 | WTARULDDTDQWMU-UHFFFAOYSA-N | 14896 | CC1(C2CCC(=C)C1C2)C | Sum of Isomers | No | Primary | 4.2 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Myrcene
β-myrcene |
123-35-3 | UAHWPYUMFXYFJY-UHFFFAOYSA-N | 31253 | CC(=CCCC(=C)C=C)C | Monomolecular | No | Primary | 5.8 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |