761
Unique InChIKey
337
Unique Receptor Sequence
23
Unique Co-Receptor Sequence
1113
EC50 Parameter
41
Unique DOI
Results
Showing 35101 to 35130 of 35891 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Salicylate | 119-36-8 | OSWPMRLSEDHDFF-UHFFFAOYSA-N | 4133 | COC(=O)C1=CC=CC=C1O | Monomolecular | No | Secondary | 2.25 Spikes/s | Raw | 0.1 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
3,7,11,15-Tetramethyl-2-hexadecen-1-ol
3,7,11,15-Tetramethyl-2-hexadecen-1-ol (mixture of isomers) |
7541-49-3 | BOTWFXYSPFMFNR-HMMYKYKNSA-N | 5366244 | CC(C)CCCC(C)CCCC(C)CCC/C(=C/CO)/C | Sum of Isomers | Yes | Primary | 8 Spikes/s | Raw | 100 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Thymol | 89-83-8 | MGSRCZKZVOBKFT-UHFFFAOYSA-N | 6989 | CC1=CC(=C(C=C1)C(C)C)O | Monomolecular | Yes | Primary | 5 Spikes/s | Raw | 100 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
(Z)-7-dodecenyl acetate
(Z)-7-dodecen-1-yl acetate |
14959-86-5 | MUZGQHWTRUVFLG-SREVYHEPSA-N | 5363527 | CCCC/C=C\CCCCCCOC(=O)C | Monomolecular | Yes | Primary | 7.25 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
(Z)-9-Tetradecenyl acetate
(Z)-9-tetradecen-1-yl acetate |
16725-53-4 | XXPBOEBNDHAAQH-SREVYHEPSA-N | 5364714 | CCCC/C=C\CCCCCCCCOC(=O)C | Monomolecular | Yes | Primary | 6.5 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Myristoleyl alcohol
(Z)-9-tetradecen-1-ol |
35153-15-2 | GSAAJQNJNPBBSX-WAYWQWQTSA-N | 5364712 | CCCC/C=C\CCCCCCCCO | Monomolecular | Yes | Primary | 6.5 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Myristyl Acetate
Tetradecyl acetate |
638-59-5 | IOUUIFSIQMVYKP-UHFFFAOYSA-N | 12531 | CCCCCCCCCCCCCCOC(=O)C | Monomolecular | No | Primary | 4 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
11-Tetradecenyl acetate, (11Z)-
(Z)-11-tetradecen-1-yl acetate |
20711-10-8 | YJINQJFQLQIYHX-PLNGDYQASA-N | 5367692 | CC/C=C\CCCCCCCCCCOC(=O)C | Monomolecular | Yes | Primary | 13.75 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
11-Tetradecenyl acetate, (11E)-
(E)-11-tetradecen-1-yl acetate |
33189-72-9 | YJINQJFQLQIYHX-SNAWJCMRSA-N | 5367650 | CC/C=C/CCCCCCCCCCOC(=O)C | Monomolecular | No | Primary | 4.5 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl Acetate | 141-78-6 | XEKOWRVHYACXOJ-UHFFFAOYSA-N | 8857 | CCOC(=O)C | Monomolecular | No | Primary | 3.933 Spikes/s | Raw | 0.1 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl hexanoate | 123-66-0 | SHZIWNPUGXLXDT-UHFFFAOYSA-N | 31265 | CCCCCC(=O)OCC | Monomolecular | Yes | Primary | 7 Spikes/s | Raw | 0.1 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Heptanone | 110-43-0 | CATSNJVOTSVZJV-UHFFFAOYSA-N | 8051 | CCCCCC(=O)C | Monomolecular | Yes | Primary | 22.667 Spikes/s | Raw | 0.1 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | No | Dose-Response | 5.25 Spikes/s | Raw | 0.01 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 14 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 40.4 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 99.8 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 117.6 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 13 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 18.6 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 38.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 77.6 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Phenylacetaldehyde
2-phenylacetaldehyde |
122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 111.333 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Heptanol
1-Heptanol |
111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | Yes | Dose-Response | 12.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Heptanol
1-Heptanol |
111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | Yes | Dose-Response | 34.8 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Heptanol
1-Heptanol |
111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | Yes | Dose-Response | 80.133 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 14.6 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 19 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 30.8 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 56.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or25 | CAB3517108.1 | C157W · H158F · A159... | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 100.6 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |