M2OR : Database of Olfactory Receptors-Molecule Measurments

Heptanol

CID: 8129

InChIKey: BBMCTIGTTCKYKF-UHFFFAOYSA-N

SMILES: CCCCCCCO

Mixture: Monomolecular

Synonyms: 1-HEPTANOL, Heptan-1-ol, Heptyl alcohol ...

Unique InChIKey

Unique Receptor Sequence

Unique Co-Receptor Sequence

EC50 Parameter

Unique DOI

Showing 1 to 30 of 116 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera frugiperda	Or40	A0A9R0D2T2	-	MEELPDISEEFIEPILPCLSLLRNAHILIY ...	Spodoptera frugiperda	Orco	A0A9F1UC78	-	MMTKVKAQGLVSDLMPNIKLMQAAGHFLFN ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	0 nA	Raw	1.000e-4 M	7	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Wang, Z., Wang, X., Liu, W., C ...	10.3390/insects15080564	N.A.
Apolygus lucorum	Or28	KP010360	-	MAGYGRLEDGDIVDGLSIWYLKASGLWEMF ...	Apolygus lucorum	Orco	AHC72290.1	-	MQKVKMHGLVGDLWPNIRLMQLTGHWLLEY ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	0 nA	Raw	1.000e-4 mol/L	6	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Yan, S.-W., Zhang, J., Liu, Y. ...	10.1016/j.jinsphys.2015.06.002	N.A.
Apolygus lucorum	Or30	KP010361	-	MVEKSNFHVKRAQLFKAYNSIHWLTLTKWF ...	Apolygus lucorum	Orco	AHC72290.1	-	MQKVKMHGLVGDLWPNIRLMQLTGHWLLEY ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	0 nA	Raw	1.000e-4 mol/L	6	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Yan, S.-W., Zhang, J., Liu, Y. ...	10.1016/j.jinsphys.2015.06.002	N.A.
Apolygus lucorum	Or12	KP010358	-	MKFIDKLAEEEDDELIEILKGNYWHFLFYS ...	Apolygus lucorum	Orco	AHC72290.1	-	MQKVKMHGLVGDLWPNIRLMQLTGHWLLEY ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	0 nA	Raw	1.000e-4 mol/L	6	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Yan, S.-W., Zhang, J., Liu, Y. ...	10.1016/j.jinsphys.2015.06.002	N.A.
Apolygus lucorum	Or18	KP010359	-	MSFSFVEKYQLSPETEKTMVTEYSYLLYVG ...	Apolygus lucorum	Orco	AHC72290.1	-	MQKVKMHGLVGDLWPNIRLMQLTGHWLLEY ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	0 nA	Raw	1.000e-4 mol/L	6	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Yan, S.-W., Zhang, J., Liu, Y. ...	10.1016/j.jinsphys.2015.06.002	N.A.
Spodoptera littoralis	Or3	CAH1641796	-	MDEAFLAFHRVLSFAGISIFAKQNWNSHRW ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	7.818 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Primary	14 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or5	QEY02574	-	MTNQKDLDFENIFKITTTALHISGSHPSVP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	3.833 Spikes/s	Raw	100 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or6	gb\|ACL81183.1\|	S411G	MGLKKFLFEDESVQGITAPTDYLYVKLLRM ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	10.9 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or7	emb\|CAB3512139.1\|	E4K · I8F · N9D · K1...	MPKPLLFDGSLDKLGVLFRYSGMNLEKDII ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	6.714 Spikes/s	Raw	100 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or9	CAB3505775	I128V · T270K	MVEPFQKCLSQVNFFCKLLGMNIDYRGDSE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	10 Spikes/s	Raw	100 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or10	CAB3508033	L9I · P162S · Q256E ...	MEAEKNTTIFLGRPKKILTAHGVWPHPNNY ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Primary	8.714 Spikes/s	Raw	100 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or13	gb\|ACL81181.1\|	-	MDIKLSSVKIFSDGSDLEGIEKVEDILYLR ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	10.167 Spikes/s	Raw	100 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or14	CAB3517316	M127V	MTETRPKHYFGFHYRILRFLGLGWWHHPEE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Primary	13.7 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Primary	16.5 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or19	CAB3507812	V82A · N224S · I229R	MKNHYILKTYCKRIFLIGSGNFWYKESEIG ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Primary	11.818 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	9 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Primary	8.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or24	CAB3517108	V307L · N380S	MRVLSHVWRRISQSKALELAGPLETAFFAS ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Dose-Response	2.667 Spikes/s	Raw	0.1 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or24	CAB3517108	V307L · N380S	MRVLSHVWRRISQSKALELAGPLETAFFAS ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Dose-Response	3.2 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or24	CAB3517108	V307L · N380S	MRVLSHVWRRISQSKALELAGPLETAFFAS ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	21.4 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or24	CAB3517108	V307L · N380S	MRVLSHVWRRISQSKALELAGPLETAFFAS ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	56.267 Spikes/s	Raw	100 µg	15	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	12.2 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	34.8 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	80.133 Spikes/s	Raw	100 µg	15	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Dose-Response	7 Spikes/s	Raw	0.1 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	7.833 Spikes/s	Raw	100 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	3.667 Spikes/s	Raw	1 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	7.222 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Dose-Response	2.2 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.

« Previous
Next »

Showing 1 to 30 of 116 results