M2OR : Database of Olfactory Receptors-Molecule Measurments

Beta-Pinene

CID: 14896

InChIKey: WTARULDDTDQWMU-UHFFFAOYSA-N

SMILES: CC1(C2CCC(=C)C1C2)C

Mixture: Sum of Isomers

Synonyms: BETA-PINENE, 127-91-3, Nopinene ...

Unique InChIKey

Unique Receptor Sequence

Unique Co-Receptor Sequence

EC50 Parameter

Unique DOI

Showing 1 to 30 of 92 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera frugiperda	Or40	A0A9R0D2T2	-	MEELPDISEEFIEPILPCLSLLRNAHILIY ...	Spodoptera frugiperda	Orco	A0A9F1UC78	-	MMTKVKAQGLVSDLMPNIKLMQAAGHFLFN ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	0 nA	Raw	1.000e-4 M	7	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Wang, Z., Wang, X., Liu, W., C ...	10.3390/insects15080564	N.A.
Spodoptera littoralis	Or3	CAH1641796	-	MDEAFLAFHRVLSFAGISIFAKQNWNSHRW ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	5.333 Spikes/s	Raw	100 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	Yes	Dose-Response	29.313 Spikes/s	Raw	100 µg	16	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Dose-Response	6.8 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Dose-Response	4.5 Spikes/s	Raw	1 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Dose-Response	7.286 Spikes/s	Raw	10 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or5	QEY02574	-	MTNQKDLDFENIFKITTTALHISGSHPSVP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	1.167 Spikes/s	Raw	100 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or6	gb\|ACL81183.1\|	S411G	MGLKKFLFEDESVQGITAPTDYLYVKLLRM ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	Yes	Primary	15.5 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or7	emb\|CAB3512139.1\|	E4K · I8F · N9D · K1...	MPKPLLFDGSLDKLGVLFRYSGMNLEKDII ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	0 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or9	CAB3505775	I128V · T270K	MVEPFQKCLSQVNFFCKLLGMNIDYRGDSE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	0.333 Spikes/s	Raw	100 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or10	CAB3508033	L9I · P162S · Q256E ...	MEAEKNTTIFLGRPKKILTAHGVWPHPNNY ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	1.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or13	gb\|ACL81181.1\|	-	MDIKLSSVKIFSDGSDLEGIEKVEDILYLR ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or14	CAB3517316	M127V	MTETRPKHYFGFHYRILRFLGLGWWHHPEE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	7.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	5.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or19	CAB3507812	V82A · N224S · I229R	MKNHYILKTYCKRIFLIGSGNFWYKESEIG ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	2.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	2.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	3.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or24	CAB3517108	V307L · N380S	MRVLSHVWRRISQSKALELAGPLETAFFAS ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	Yes	Primary	4.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	4.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	1 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or27	CAB3507814	-	MIILNENMKTKLAFLSPVVPYGVFESWEDL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	4.833 Spikes/s	Raw	100 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or28	ABQ84982	-	MTSLYRKFLFKKKLKQRIDERVYNKRDYDA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	11.375 Spikes/s	Raw	100 µg	8	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or29	CAB3514226	I38V · T159M · I243T	MNSFLQSLEDPARPFLGPNYWILKKMGLLL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	Yes	Primary	29 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or30	emb\|CAB3517297.1\|	D5C · K10E · M11L · ...	MDATCLNFEELFKIRTVFMRLNRSHPSIAR ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	1.5 Spikes/s	Raw	100 µg	2	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or31	emb\|CAB3514346.1\|	-	MEDNVAYSTFEGFRPHFDALARVGYFKIVL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	11.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or32	CAB3508034	A100S	MVSSEDLFLNRAKFVMKYLGVWVLADNASY ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	0.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or35	CAB3509398	D11E · N244D · D250_...	MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	Yes	Primary	20.444 Spikes/s	Raw	100 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or36	CAB3509397	Y110C · T136S	MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	8.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Helicoverpa armigera	Or10	A0A075T2W7	-	SWTIPMTGRLSSNPNKIMAVKNTSLFLGRP ...	Helicoverpa armigera	Orco	A0A075TD45	-	MMTKVKAQGLVSDLMPNIKLMQMAGHFLFN ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	N.A.	N.A.	1.000e-4 M	N.A.	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Guo, M., Du, L., Chen, Q., Fen ...	10.1093/molbev/msaa300	N.A.
Helicoverpa armigera	Or12	A0A075T622	-	MEDEPLLIDKTVKKIEFLFRCTGINIKSGT ...	Helicoverpa armigera	Orco	A0A075TD45	-	MMTKVKAQGLVSDLMPNIKLMQMAGHFLFN ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	N.A.	N.A.	1.000e-4 M	N.A.	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Guo, M., Du, L., Chen, Q., Fen ...	10.1093/molbev/msaa300	N.A.

« Previous
Next »

Showing 1 to 30 of 92 results