New Database Available - Released on 02/10/2026.
|
|
About Us Contact Us How To Documentation
About Us Contact Us How To Documentation
761
Unique InChIKey
337
Unique Receptor Sequence
23
Unique Co-Receptor Sequence
1113
EC50 Parameter
41
Unique DOI
Results
Showing 32371 to 32400 of 35891 results
 
10
30
50
100
150
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Benzyl acetate 140-11-4 QUKGYYKBILRGFE-UHFFFAOYSA-N 8785 CC(=O)OCC1=CC=CC=C1 Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Dihydrobenzofuran
2,3-Dihydro-benzofuran 		496-16-2 HBEDSQVIWPRPAY-UHFFFAOYSA-N 10329 C1COC2=CC=CC=C21 Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Bicyclo(3.1.1)hept-3-en-2-ol, 4,6,6-trimethyl-, (1R,2S,5R)-rel-
(+)-trans-Verbenol 		22339-08-8 WONIGEXYPVIKFS-VGMNWLOBSA-N 89664 CC1=C[C@@H]([C@@H]2C[C@H]1C2(C)C)O Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (1R,5S,7S)-7-ethyl-5-methyl-6,8-dioxabicyclo[3.2.1]octane
(+-)-endo-Brevicomin 		22625-19-0 YONXEBYXWVCXIV-YIZRAAEISA-N 182344 CC[C@H]1[C@H]2CCC[C@](O2)(O1)C Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (1S,5S)-6,6-Dimethyl-2-methylenebicyclo[3.1.1]heptan-3-one
Pinocarvone, trans-(-)- 		19890-00-7 TZDMGBLPGZXHJI-JGVFFNPUSA-N 12314319 CC1([C@H]2C[C@@H]1C(=C)C(=O)C2)C Monomolecular No Primary < 3 % Norm. receptor 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-7-octen-4-ol
(+-)-Ipsenol 		14314-21-7 RHAXCOKCIAVHPB-UHFFFAOYSA-N 85712 CC(C)CC(CC(=C)C=C)O Sum of Isomers Yes Dose-Response 9.06 µM EC50 N.A. 12 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Figure 3
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (-)-Ipsenol 35628-05-8 RHAXCOKCIAVHPB-JTQLQIEISA-N 93186 CC(C)C[C@@H](CC(=C)C=C)O Monomolecular Yes Dose-Response 1.98 µM EC50 N.A. 12 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Figure 3
Ips typographus Or46 A0A7L8XZ66 T205A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (-)-Ipsenol 35628-05-8 RHAXCOKCIAVHPB-JTQLQIEISA-N 93186 CC(C)C[C@@H](CC(=C)C=C)O Monomolecular No Dose-Response N.A. EC50 N.A. 12 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Figure 7
Ips typographus Or46 A0A7L8XZ66 Y84A MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (-)-Ipsenol 35628-05-8 RHAXCOKCIAVHPB-JTQLQIEISA-N 93186 CC(C)C[C@@H](CC(=C)C=C)O Monomolecular No Dose-Response N.A. EC50 N.A. 12 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Figure 7
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-2,7-octadien-4-ol
(+/-)-Ipsdienol 		14434-41-4 NHMKYUHMPXBMFI-UHFFFAOYSA-N 85734 CC(=CC(CC(=C)C=C)O)C Sum of Isomers Yes Dose-Response 5.34 µM EC50 N.A. 12 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Figure 4
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (4R)-2-Methyl-6-methylene-2,7-octadien-4-ol
(-)-Ipsdienol 		60894-97-5 NHMKYUHMPXBMFI-JTQLQIEISA-N 181296 CC(=C[C@@H](CC(=C)C=C)O)C Monomolecular Yes Dose-Response 9.47 µM EC50 N.A. 12 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Figure 4
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Vuaa1 525582-84-7 UWCCKVJVOHTHAF-UHFFFAOYSA-N 1319135 CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... Monomolecular Yes Primary 564 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 3,7-Octadien-2-ol, 2-methyl-6-methylene-, (E)-
(E)-2-Methyl-6-methylene-3,7-octadien-2-ol 		6994-89-4 NOEQSPUVXRMJBW-SOFGYWHQSA-N 5363351 CC(C)(/C=C/CC(=C)C=C)O Monomolecular No Primary 202 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (S)-cis-Verbenol
(-)-cis-Verbenol 		18881-04-4 WONIGEXYPVIKFS-YIZRAAEISA-N 87839 CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O Monomolecular No Primary 0 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Myrcene 123-35-3 UAHWPYUMFXYFJY-UHFFFAOYSA-N 31253 CC(=CCCC(=C)C=C)C Monomolecular No Primary 6 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-2,7-octadien-4-ol
(+/-)-Ipsdienol 		14434-41-4 NHMKYUHMPXBMFI-UHFFFAOYSA-N 85734 CC(=CC(CC(=C)C=C)O)C Sum of Isomers Yes Primary 1,852 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or46 A0A7L8XZ66 - MNAFPDSDSLTALKFTSVLGLFPWKLAFQQ ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-7-octen-4-ol
(±)-Ipsenol 		14314-21-7 RHAXCOKCIAVHPB-UHFFFAOYSA-N 85712 CC(C)CC(CC(=C)C=C)O Sum of Isomers Yes Primary 4,080 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Vuaa1 525582-84-7 UWCCKVJVOHTHAF-UHFFFAOYSA-N 1319135 CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... Monomolecular Yes Primary < 250 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 3,7-Octadien-2-ol, 2-methyl-6-methylene-, (E)-
(E)-2-Methyl-6-methylene-3,7-octadien-2-ol 		6994-89-4 NOEQSPUVXRMJBW-SOFGYWHQSA-N 5363351 CC(C)(/C=C/CC(=C)C=C)O Monomolecular No Primary < 10 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (S)-cis-Verbenol
(-)-cis-Verbenol 		18881-04-4 WONIGEXYPVIKFS-YIZRAAEISA-N 87839 CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O Monomolecular No Primary < 10 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Myrcene 123-35-3 UAHWPYUMFXYFJY-UHFFFAOYSA-N 31253 CC(=CCCC(=C)C=C)C Monomolecular No Primary < 10 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-2,7-octadien-4-ol
(+/-)-Ipsdienol 		14434-41-4 NHMKYUHMPXBMFI-UHFFFAOYSA-N 85734 CC(=CC(CC(=C)C=C)O)C Sum of Isomers No Primary < 10 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or49 A0A7L8XYT4 - MTMTIYPKTENMRLTAIYSSTLGIFPWKFL ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-7-octen-4-ol
(±)-Ipsenol 		14314-21-7 RHAXCOKCIAVHPB-UHFFFAOYSA-N 85712 CC(C)CC(CC(=C)C=C)O Sum of Isomers No Primary < 10 nA Norm. other 30 µM 5 Two-electrode Voltage Clamp N.A. Current Amplitude Xenopus oocytes N.A. N.A. Liquid 2 mL/min N.A. 20 s Yuvaraj, J. K., Roberts, R. E. ... 10.1186/s12915-020-00946-6 Supplementary Data 2
Ips typographus Or36 WZI48883.1 - MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Vuaa1 525582-84-7 UWCCKVJVOHTHAF-UHFFFAOYSA-N 1319135 CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... Monomolecular Yes Primary 13.425 %Δ fluorescence Norm. other 50 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Kandasamy, D., ... 10.1186/s12915-024-02066-x Additional File 2
Ips typographus Or36 WZI48883.1 - MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (S)-cis-Verbenol
(-)-cis-Verbenol 		18881-04-4 WONIGEXYPVIKFS-YIZRAAEISA-N 87839 CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O Monomolecular No Primary -0.346 %Δ fluorescence Norm. other 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Kandasamy, D., ... 10.1186/s12915-024-02066-x Additional File 2
Ips typographus Or36 WZI48883.1 - MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Verbenol, (S)-trans-
(-)-trans-Verbenol 		19890-02-9 WONIGEXYPVIKFS-DJLDLDEBSA-N 88298 CC1=C[C@H]([C@H]2C[C@@H]1C2(C)C)O Monomolecular No Primary -0.56 %Δ fluorescence Norm. other 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Kandasamy, D., ... 10.1186/s12915-024-02066-x Additional File 2
Ips typographus Or36 WZI48883.1 - MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... Ips typographus Orco A0A7L8XYY7 - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Levoverbenone
(-)-Verbenone 		1196-01-6 DCSCXTJOXBUFGB-JGVFFNPUSA-N 92874 CC1=CC(=O)[C@H]2C[C@@H]1C2(C)C Monomolecular No Primary -0.019 %Δ fluorescence Norm. other 30 µM 9 Calcium Imaging FLUOstar Omega plate reader ∆ Fluorescence HEK HEK293 pcDNA5/TO Liquid N.A. N.A. N.A. Yuvaraj, J. K., Kandasamy, D., ... 10.1186/s12915-024-02066-x Additional File 2
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference
References Versions How To Documentation
M2iOR v1.0.2 · 2026-10-02   All Rights Reserved.