M2OR : Database of Olfactory Receptors-Molecule Measurments

Unique InChIKey

Unique Receptor Sequence

Unique Co-Receptor Sequence

EC50 Parameter

Unique DOI

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Or25	emb\|CAB3517108.1\|	100.00	Spodoptera littoralis		MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...
	Or25	emb\|CAB3517108.1\|	95.18	Spodoptera littoralis	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...

Showing 31 to 60 of 88 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	Yes	Dose-Response	36.4 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	Yes	Dose-Response	65.6 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	Yes	Dose-Response	97.667 Spikes/s	Raw	100 µg	15	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Benzaldehyde	100-52-7	HUMNYLRZRPPJDN-UHFFFAOYSA-N	240	C1=CC=C(C=C1)C=O	Monomolecular	No	Dose-Response	4 Spikes/s	Raw	1.000e-4 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Benzaldehyde	100-52-7	HUMNYLRZRPPJDN-UHFFFAOYSA-N	240	C1=CC=C(C=C1)C=O	Monomolecular	No	Dose-Response	4 Spikes/s	Raw	0.001 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Phenylacetaldehyde	122-78-1	DTUQWGWMVIHBKE-UHFFFAOYSA-N	998	C1=CC=C(C=C1)CC=O	Monomolecular	No	Dose-Response	2 Spikes/s	Raw	1.000e-4 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Phenylacetaldehyde	122-78-1	DTUQWGWMVIHBKE-UHFFFAOYSA-N	998	C1=CC=C(C=C1)CC=O	Monomolecular	No	Dose-Response	6 Spikes/s	Raw	0.001 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Dose-Response	7 Spikes/s	Raw	0.1 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Benzyl Alcohol	100-51-6	WVDDGKGOMKODPV-UHFFFAOYSA-N	244	C1=CC=C(C=C1)CO	Monomolecular	No	Dose-Response	6 Spikes/s	Raw	1.000e-4 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	No	Dose-Response	11 Spikes/s	Raw	1.000e-4 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	No	Dose-Response	8 Spikes/s	Raw	0.001 µg	1	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	No	Dose-Response	4.333 Spikes/s	Raw	0.01 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	Yes	Secondary	17.9 Spikes/s	Raw	0.1 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Humulene	6753-98-6	FAMPSKZZVDUYOS-HRGUGZIWSA-N	5281520	C/C/1=C\CC(/C=C/C/C(=C/CC1)/C)(C)C	Monomolecular	No	Primary	4.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(-)-Caryophyllene	87-44-5	NPNUFJAVOOONJE-GFUGXAQUSA-N	5281515	C/C/1=C\CCC(=C)[C@H]2CC([C@@H]2CC1)(C)C	Monomolecular	No	Primary	6.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	3-Carene	13466-78-9	BQOFWKZOCNGFEC-UHFFFAOYSA-N	26049	CC1=CCC2C(C1)C2(C)C	Sum of Isomers	No	Primary	5.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Copaene	3856-25-5	VLXDPFLIRFYIME-BTFPBAQTSA-N	12303902	CC1=CC[C@H]2[C@H]3[C@@H]1[C@@]2(CC[C@H]3 ...	Monomolecular	No	Primary	7.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Farnesene	502-61-4	CXENHBSYCFFKJS-VDQVFBMKSA-N	5281516	CC(=CCC/C(=C/C/C=C(\C)/C=C)/C)C	Monomolecular	No	Primary	8.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	alpha-Pinene, (+)-	7785-70-8	GRWFGVWFFZKLTI-RKDXNWHRSA-N	82227	CC1=CC[C@@H]2C[C@H]1C2(C)C	Monomolecular	No	Primary	4.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	4.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myrcene	123-35-3	UAHWPYUMFXYFJY-UHFFFAOYSA-N	31253	CC(=CCCC(=C)C=C)C	Monomolecular	No	Primary	5.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	beta-OCIMENE, (3E)-	3779-61-1	IHPKGUQCSIINRJ-CSKARUKUSA-N	5281553	CC(=CC/C=C(\C)/C=C)C	Monomolecular	No	Primary	4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Indole	120-72-9	SIKJAQJRHWYJAI-UHFFFAOYSA-N	798	C1=CC=C2C(=C1)C=CN2	Monomolecular	No	Primary	5 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(3E)-4,8-dimethyl-1,3,7-nonatriene	19945-61-0	LUKZREJJLWEWQM-YRNVUSSQSA-N	6427110	CC(=CCC/C(=C/C=C)/C)C	Monomolecular	No	Primary	7.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(E,E)-4,8,12-Trimethyl-1,3,7,11-tridecatetraene	62235-06-7	CWLVBFJCJXHUCF-RNPYNJAESA-N	6443227	CC(=CCC/C(=C/CC/C(=C/C=C)/C)/C)C	Monomolecular	No	Primary	7.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Jasmone	488-10-8	XMLSXPIVAXONDL-PLNGDYQASA-N	1549018	CC/C=C\CC1=C(CCC1=O)C	Monomolecular	Yes	Primary	10.714 Spikes/s	Raw	100 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Decanal	112-31-2	KSMVZQYAVGTKIV-UHFFFAOYSA-N	8175	CCCCCCCCCC=O	Monomolecular	No	Primary	8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Nonanal	124-19-6	GYHFUZHODSMOHU-UHFFFAOYSA-N	31289	CCCCCCCCC=O	Monomolecular	Yes	Primary	11.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(2E)-1-(6-bromo-2-methyl-4-phenylquinolin-3-yl)-3-(1,3-diphenyl-1H-pyrazol-4-yl)prop-2-en-1-one	6728‐26‐3	DRLWUIYQAYZENU-LVZFUZTISA-N	5291168	CC1=C(C(=C2C=C(C=CC2=N1)Br)C3=CC=CC=C3)C ...	Monomolecular	Yes	Primary	57.8 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or25	emb\|CAB3517108.1\|	C157W · H158F · A159...	MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	2-Hexen-1-ol	2305-21-7	ZCHHRLHTBGRGOT-SNAWJCMRSA-N	5318042	CCC/C=C/CO	Monomolecular	Yes	Primary	59.8 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.

Showing 31 to 60 of 88 results