84
Unique InChIKey
14
Unique Receptor Sequence
2
Unique Co-Receptor Sequence
37
EC50 Parameter
4
Unique DOI
BLAST (Receptor variants)
| Orco | ref|XP_081832551.1| | 99.79 | Ips typographus | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | |
| Orco | ref|XP_081832551.1| | 100.00 | Ips typographus | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Results
Showing 601 to 630 of 701 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | N.A. | Dose-Response | 0.823 % | Norm. receptor | 4.690e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | N.A. | Dose-Response | -0.417 % | Norm. receptor | 5.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | N.A. | Dose-Response | 2.861 % | Norm. receptor | 7.500e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | N.A. | Dose-Response | 1.625 % | Norm. receptor | 9.380e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | Yes | Dose-Response | 24.48 µM | EC50 | N.A. | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.009 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.943 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.065 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.952 % | Norm. receptor | 1.880e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.178 % | Norm. receptor | 2.340e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.004 % | Norm. receptor | 2.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.307 % | Norm. receptor | 3.750e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.604 % | Norm. receptor | 4.690e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.945 % | Norm. receptor | 5.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 4.027 % | Norm. receptor | 7.500e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.668 % | Norm. receptor | 9.380e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.537 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.867 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.71 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.432 % | Norm. receptor | 1.880e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.991 % | Norm. receptor | 2.340e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.1 % | Norm. receptor | 2.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.988 % | Norm. receptor | 3.750e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.373 % | Norm. receptor | 4.690e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.068 % | Norm. receptor | 5.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.012 % | Norm. receptor | 7.500e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.949 % | Norm. receptor | 9.380e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | trans-Pinocamphone (pinocamphone) | N.A. | MQPHVIPKLRXGDJ-BIIVOSGPSA-N | 6430551 | C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.952 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | trans-Pinocamphone (pinocamphone) | N.A. | MQPHVIPKLRXGDJ-BIIVOSGPSA-N | 6430551 | C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.415 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | trans-Pinocamphone (pinocamphone) | N.A. | MQPHVIPKLRXGDJ-BIIVOSGPSA-N | 6430551 | C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.175 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |