44
Unique InChIKey
2
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
6
EC50 Parameter
2
Unique DOI
BLAST (Receptor variants)
| Or29 | A0A8F3IVT0 | 100.00 | Ips typographus | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | ||
| Or29 | A0A8F3IVT0 | 99.75 | Ips typographus | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | |
| Or29 | A0A8F3IVT0 | 99.75 | Ips typographus | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... |
Results
Showing 31 to 60 of 88 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (+)-3-Carene | 498-15-7 | BQOFWKZOCNGFEC-BDAKNGLRSA-N | 443156 | CC1=CC[C@@H]2[C@H](C1)C2(C)C | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 3-Octanol | 589-98-0 | NMRPBPVERJPACX-UHFFFAOYSA-N | 11527 | CCCCCC(CC)O | Sum of Isomers | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 1-Octen-3-Ol | 3391-86-4 | VSMOENVRRABVKN-UHFFFAOYSA-N | 18827 | CCCCCC(C=C)O | Sum of Isomers | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Ethanol | 64-17-5 | LFQSCWFLJHTTHZ-UHFFFAOYSA-N | 702 | CCO | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | (5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane | 68108-90-7 | XNNASGSBOJGKAZ-IUCAKERBSA-N | 155085 | C[C@H]1CCC[C@]2(O1)CCCO2 | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 2-Phenylethanol | 1960-12-08 | WRMNZCZEMHIOCP-UHFFFAOYSA-N | 6054 | C1=CC=C(C=C1)CCO | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Styrene | 100-42-5 | PPBRXRYQALVLMV-UHFFFAOYSA-N | 7501 | C=CC1=CC=CC=C1 | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 4-Methoxystyrene | 637-69-4 | UAJRSHJHFRVGMG-UHFFFAOYSA-N | 12507 | COC1=CC=C(C=C1)C=C | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Estragole | 140-67-0 | ZFMSMUAANRJZFM-UHFFFAOYSA-N | 8815 | COC1=CC=C(C=C1)CC=C | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 3,4-Dimethoxytoluene | 494-99-5 | GYPMBQZAVBFUIZ-UHFFFAOYSA-N | 68126 | CC1=CC(=C(C=C1)OC)OC | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Methyleugenol | 93-15-2 | ZYEMGPIYFIJGTP-UHFFFAOYSA-N | 7127 | COC1=C(C=C(C=C1)CC=C)OC | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | 4-Ethylguaiacol | 2785-89-9 | CHWNEIVBYREQRF-UHFFFAOYSA-N | 62465 | CCC1=CC(=C(C=C1)O)OC | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | manual two-electrode voltage clamp | Current Amplitude | Xenopus Ooctye | N.A. | pT7T | Liquid | N.A. | N.A. | N.A. | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.009 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.943 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.065 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.952 % | Norm. receptor | 1.880e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.178 % | Norm. receptor | 2.340e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.004 % | Norm. receptor | 2.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.307 % | Norm. receptor | 3.750e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.604 % | Norm. receptor | 4.690e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.945 % | Norm. receptor | 5.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 4.027 % | Norm. receptor | 7.500e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Isopinocamphone | 14575-93-0 | MQPHVIPKLRXGDJ-RNJXMRFFSA-N | 84532 | C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.668 % | Norm. receptor | 9.380e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.537 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.867 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.71 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.432 % | Norm. receptor | 1.880e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | ref|XP_081832551.1| | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... | Pinocamphone | 547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.991 % | Norm. receptor | 2.340e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |