New Database Available - Released on 02/10/2026.
567
Unique InChIKey
218
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
848
EC50 Parameter
21
Unique DOI
Receptor Name
Accession
Identity (%)
Species
Mutations
Sequence
Orco Q9VNB5 100.00 Drosophila melanogaster MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...
Showing 24421 to 24450 of 24584 results
 
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Carene 13466-78-9 BQOFWKZOCNGFEC-UHFFFAOYSA-N 26049 CC1=CCC2C(C1)C2(C)C Sum of Isomers Yes Dose-Response 58.333 Spikes/s Raw 100 µg 15 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Copaene
α-copaene
3856-25-5 VLXDPFLIRFYIME-BTFPBAQTSA-N 12303902 CC1=CC[C@H]2[C@H]3[C@@H]1[C@@]2(CC[C@H]3 ... Monomolecular No Primary 7.667 Spikes/s Raw 100 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Farnesene
(E,E)-α-farnesene
502-61-4 CXENHBSYCFFKJS-VDQVFBMKSA-N 5281516 CC(=CCC/C(=C/C/C=C(\C)/C=C)/C)C Monomolecular No Primary 8.667 Spikes/s Raw 100 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (+-)-alpha-Pinene
α-pinene
80-56-8 GRWFGVWFFZKLTI-UHFFFAOYSA-N 6654 CC1=CCC2CC1C2(C)C Sum of Isomers Yes Dose-Response 42.536 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Beta-Pinene
β-pinene
127-91-3 WTARULDDTDQWMU-UHFFFAOYSA-N 14896 CC1(C2CCC(=C)C1C2)C Sum of Isomers Yes Primary 20.444 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Myrcene
β-myrcene
123-35-3 UAHWPYUMFXYFJY-UHFFFAOYSA-N 31253 CC(=CCCC(=C)C=C)C Monomolecular No Primary 13.4 Spikes/s Raw 100 µg 10 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... beta-OCIMENE, (3E)-
(E)-ocimene
3779-61-1 IHPKGUQCSIINRJ-CSKARUKUSA-N 5281553 CC(=CC/C=C(\C)/C=C)C Monomolecular Yes Primary 20.111 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Indole 120-72-9 SIKJAQJRHWYJAI-UHFFFAOYSA-N 798 C1=CC=C2C(=C1)C=CN2 Monomolecular Yes Dose-Response 37.071 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (3E)-4,8-dimethyl-1,3,7-nonatriene
E-4,8-Dimethyl-1,3,7-nonatriene
19945-61-0 LUKZREJJLWEWQM-YRNVUSSQSA-N 6427110 CC(=CCC/C(=C/C=C)/C)C Monomolecular No Primary 7.6 Spikes/s Raw 100 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (E,E)-4,8,12-Trimethyl-1,3,7,11-tridecatetraene 62235-06-7 CWLVBFJCJXHUCF-RNPYNJAESA-N 6443227 CC(=CCC/C(=C/CC/C(=C/C=C)/C)/C)C Monomolecular No Primary 9.6 Spikes/s Raw 100 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Jasmone
(Z)-jasmone
488-10-8 XMLSXPIVAXONDL-PLNGDYQASA-N 1549018 CC/C=C\CC1=C(CCC1=O)C Monomolecular Yes Primary 19.727 Spikes/s Raw 100 µg 11 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Decanal 112-31-2 KSMVZQYAVGTKIV-UHFFFAOYSA-N 8175 CCCCCCCCCC=O Monomolecular No Primary 8.8 Spikes/s Raw 100 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Nonanal 124-19-6 GYHFUZHODSMOHU-UHFFFAOYSA-N 31289 CCCCCCCCC=O Monomolecular Yes Primary 17.929 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular Yes Primary 21.556 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Phenylacetaldehyde
2-phenylacetaldehyde
122-78-1 DTUQWGWMVIHBKE-UHFFFAOYSA-N 998 C1=CC=C(C=C1)CC=O Monomolecular Yes Primary 28.444 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... trans-2-Hexenal
(E)-2-hexenal
6728-26-3 MBDOYVRWFFCFHM-SNAWJCMRSA-N 5281168 CCC/C=C/C=O Monomolecular No Primary 14.222 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 2-Hexen-1-ol
(E)-2-hexenol
2305-21-7 ZCHHRLHTBGRGOT-SNAWJCMRSA-N 5318042 CCC/C=C/CO Monomolecular Yes Primary 32.889 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol
Z-3-Hexenol
928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular Yes Dose-Response 33.357 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Hexanol 111-27-3 ZSIAUFGUXNUGDI-UHFFFAOYSA-N 8103 CCCCCCO Monomolecular Yes Primary 32.643 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Heptanol
1-Heptanol
111-70-6 BBMCTIGTTCKYKF-UHFFFAOYSA-N 8129 CCCCCCCO Monomolecular Yes Primary 33.143 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Nonanol 143-08-8 ZWRUINPWMLAQRD-UHFFFAOYSA-N 8914 CCCCCCCCCO Monomolecular No Primary 7.364 Spikes/s Raw 100 µg 11 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Octanol 111-87-5 KBPLFHHGFOOTCA-UHFFFAOYSA-N 957 CCCCCCCCO Monomolecular Yes Primary 23.778 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular Yes Primary 23.778 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Carvacrol 499-75-2 RECUKUPTGUEGMW-UHFFFAOYSA-N 10364 CC1=C(C=C(C=C1)C(C)C)O Monomolecular Yes Primary 16.444 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole
Estragol
140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular Yes Dose-Response 48.714 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Eugenol 97-53-0 RRAFCDWBNXTKKO-UHFFFAOYSA-N 3314 COC1=C(C=CC(=C1)CC=C)O Monomolecular Yes Primary 14.889 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Geraniol 106-24-1 GLZPCOQZEFWAFX-JXMROGBWSA-N 637566 CC(=CCC/C(=C/CO)/C)C Monomolecular Yes Primary 21 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool
(±)-Linalool
78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers Yes Dose-Response 35.286 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3,7,11-Trimethyldodeca-1,6,10-trien-3-ol
(+/-)-Nerolidol
142-50-7 FQTLCLSUCSAZDY-UHFFFAOYSA-N 8888 CC(=CCCC(=CCCC(C)(C=C)O)C)C Sum of Isomers No Primary 14.286 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3,7,11,15-Tetramethyl-2-hexadecen-1-ol
3,7,11,15-Tetramethyl-2-hexadecen-1-ol (mixture of isomers)
7541-49-3 BOTWFXYSPFMFNR-HMMYKYKNSA-N 5366244 CC(C)CCCC(C)CCCC(C)CCC/C(=C/CO)/C Sum of Isomers No Primary 6 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference