1
Unique InChIKey
22
Unique Receptor Sequence
3
Unique Co-Receptor Sequence
1
EC50 Parameter
5
Unique DOI
Results
Showing 1 to 30 of 38 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Or36 | WZI48883.1 | - | MASDEFIKIPKIFLILGGFWPFSVTKDPLK ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.278 %Δ fluorescence | Norm. other | 30 µM | 9 | HEK293 | Omega FluoStar | Calcium Imaging | Human | HEK293 | AGAATGCGGCCGCCACCATGGGCAAGCCTATCCCTAATCCTCTGCTGGGCCTGGACAGCACCGCGAGTGACGAGTTTATA | Liquid | N.A. | N.A. | N.A. | Yuvaraj, J. K., Kandasamy, D., ... | 10.1186/s12915-024-02066-x | Additional File 2 |
| Ips typographus | Or23 | A0A8F3ERX1 | - | MAVYPKSEHLKVPAIYCSTIGIFPWKFMFQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | TEC-03BF | Current Amplitude | Xenopus oocytes | N.A. | N.A. | Liquid | 2 mL/min | N.A. | 20 s | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | Table 1 |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | TEC-03BF | Current Amplitude | Xenopus oocytes | N.A. | N.A. | Liquid | 2 mL/min | N.A. | 20 s | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | Table 1 |
| Ips typographus | Or27 | A0A8F3EVI2 | - | MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | TEC-03BF | Current Amplitude | Xenopus oocytes | N.A. | N.A. | Liquid | 2 mL/min | N.A. | 20 s | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | Table 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | Yes | Dose-Response | N.A. | EC50 | 100 µM | 4 | Two-electrode Voltage Clamp | TEC-03BF | Current Amplitude | Xenopus oocytes | N.A. | N.A. | Liquid | 2 mL/min | N.A. | 20 s | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | Table 1 |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | N.A. | Norm. other | 100 µM | 4 | Two-electrode Voltage Clamp | TEC-03BF | Current Amplitude | Xenopus oocytes | N.A. | N.A. | Liquid | 2 mL/min | N.A. | 20 s | Hou, X.-Q., Yuvaraj, J. K., Ro ... | 10.1093/molbev/msab218 | Figure 6 |
| Ips typographus | Or23 | A0A8F3ERX1 | - | MGKPIPNPLLGLDSTAVYPKSEHLKVPAIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -0.781 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Datasheet 1 |
| Ips typographus | Or23 | A0A8F3ERX1 | - | MGKPIPNPLLGLDSTAVYPKSEHLKVPAIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.217 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Datasheet 1 |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -0.133 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 3 ; Datasheet 1 |
| Ips typographus | Or25 | A0A8F3ERC7 | - | MGKPIPNPLLGLDSTKIYPDTKFFDVTAKF ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -0.589 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 3 ; Datasheet 1 |
| Ips typographus | Or27 | A0A8F3EVI2 | - | MGKPIPNPLLGLDSTRVYPDIENFKITAIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.678 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Datasheet 1 |
| Ips typographus | Or27 | A0A8F3EVI2 | - | MGKPIPNPLLGLDSTRVYPDIENFKITAIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -1.526 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Datasheet 1 |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGKPIPNPLLGLDSTGLYPASRYFKNPIMW ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -1.786 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Datasheet 1 |
| Ips typographus | Or28 | A0A8F3IXZ3 | - | MGKPIPNPLLGLDSTGLYPASRYFKNPIMW ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.246 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.537 % | Norm. receptor | 1.500e-4 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.867 % | Norm. receptor | 1.170e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.71 % | Norm. receptor | 1.460e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.432 % | Norm. receptor | 1.880e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.991 % | Norm. receptor | 2.340e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | -0.1 % | Norm. receptor | 2.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 2.988 % | Norm. receptor | 3.750e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | Yes | Primary | 3.547 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.373 % | Norm. receptor | 4.690e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 0.068 % | Norm. receptor | 5.900e-7 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 3.012 % | Norm. receptor | 7.500e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | N.A. | Dose-Response | 1.949 % | Norm. receptor | 9.380e-6 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Ips typographus | Or29 | A0A8F3IVT0 | K111E | MGKPIPNPLLGLDSTAAYPQCKNLRVAIIY ... | Ips typographus | Orco | A0A7L8XYY7 | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | -1.221 % | Norm. receptor | 3.000e-5 M | 4 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | Figure 5 ; Datasheet 1 |
| Dendroctonus ponderosae | Or8 | XP_048521609.1 | - | MGKPIPNPLLGLDSTIKQPSYEVYATDFFS ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 1.391 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | Data S1 |
| Dendroctonus ponderosae | Or9 | XP_019768310.1 | - | MGKPIPNPLLGLDSTDTLGPALTKVRLRLP ... | Ips typographus | Orco | A0A7L8XYY7 | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.465 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | Data S1 |
| Hylobius abietis | Or3 | UQK85193 | - | MFNRTYARDFFVVNRWMLMCAGLWRPETKN ... | Hylobius abietis | Orco | Not available | - | MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... |
Pinocamphone
(-)-Pinocamphone |
547-60-4 | MQPHVIPKLRXGDJ-PRJMDXOYSA-N | 6427105 | C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O | Monomolecular | No | Primary | 0.286 % | Norm. receptor | 3.000e-5 M | 6 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNA5/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Biswas, T., Yu ... | 10.1111/mec.16494 | Data S1 |