Or4 | M2iOR

54

Unique InChIKey

1

Unique Receptor Sequence

1

Unique Co-Receptor Sequence

0

EC50 Parameter

1

Unique DOI

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Or4	CAB3516077	100.00	Spodoptera littoralis		MVNTFRGRLLNIRDRLKQNSCVNLVWLINF ...
	Or4	CAB3516077	97.59	Spodoptera littoralis	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...

Showing 61 to 70 of 70 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	alpha-Pinene, (+)-	7785-70-8	GRWFGVWFFZKLTI-RKDXNWHRSA-N	82227	CC1=CC[C@@H]2C[C@H]1C2(C)C	Monomolecular	No	Dose-Response	5.778 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Dose-Response	6.8 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Dose-Response	4.5 Spikes/s	Raw	1 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Dose-Response	7.286 Spikes/s	Raw	10 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	No	Dose-Response	6.286 Spikes/s	Raw	1.000e-4 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	No	Dose-Response	6 Spikes/s	Raw	0.001 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	No	Dose-Response	7.143 Spikes/s	Raw	0.01 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	No	Dose-Response	8.143 Spikes/s	Raw	0.1 µg	7	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	No	Dose-Response	12.8 Spikes/s	Raw	1 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or4	CAB3516077	Q18E · L27F · I54V ·...	MVNTFRGRLLNIRDRLKENSCVNLVWFINF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	Yes	Dose-Response	31.889 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.

« Previous
Next »

Showing 61 to 70 of 70 results

‹
1
2
3