New Database Available - Released on 29/09/2026.
|
|
About Us Contact Us How To Documentation
About Us Contact Us How To Documentation
54
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
Receptor Name
Accession
Identity (%)
Species
Mutations
Sequence
Or35 CAB3509398 100.00 Spodoptera littoralis MWNKIRKFGLDYCDLPTMIWNVAVFLKVLT ...
Or35 CAB3509398 99.02 Spodoptera littoralis D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ...
Results
Showing 61 to 85 of 85 results
 
10
30
50
100
150
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... alpha-Pinene, (+)- 7785-70-8 GRWFGVWFFZKLTI-RKDXNWHRSA-N 82227 CC1=CC[C@@H]2C[C@H]1C2(C)C Monomolecular Yes Dose-Response 18.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Indole 120-72-9 SIKJAQJRHWYJAI-UHFFFAOYSA-N 798 C1=CC=C2C(=C1)C=CN2 Monomolecular No Dose-Response 2.8 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Indole 120-72-9 SIKJAQJRHWYJAI-UHFFFAOYSA-N 798 C1=CC=C2C(=C1)C=CN2 Monomolecular No Dose-Response 7.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Indole 120-72-9 SIKJAQJRHWYJAI-UHFFFAOYSA-N 798 C1=CC=C2C(=C1)C=CN2 Monomolecular Yes Dose-Response 23.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol 928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular No Dose-Response 0.8 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol 928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular No Dose-Response 2.4 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol 928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular No Dose-Response 6.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular No Dose-Response 1.6 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular No Dose-Response 4 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular Yes Dose-Response 16 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Dose-Response 2.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Dose-Response 3.4 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Dose-Response 13 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular No Dose-Response 1.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular No Dose-Response 2 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular No Dose-Response 10.6 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 1.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 2.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 14.4 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 2.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular Yes Dose-Response 16.4 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular No Dose-Response 3 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular No Dose-Response 15 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular Yes Dose-Response 26.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference
References Versions How To Documentation
M2iOR v1.0.0 · 2026-09-29   All Rights Reserved.