New Database Available - Released on 29/09/2026.
|
|
About Us Contact Us How To Documentation
About Us Contact Us How To Documentation
54
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
Receptor Name
Accession
Identity (%)
Species
Mutations
Sequence
Or35 CAB3509398 100.00 Spodoptera littoralis MWNKIRKFGLDYCDLPTMIWNVAVFLKVLT ...
Or35 CAB3509398 99.02 Spodoptera littoralis D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ...
Results
Showing 31 to 60 of 85 results
 
10
30
50
100
150
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular Yes Dose-Response 48.714 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Eugenol 97-53-0 RRAFCDWBNXTKKO-UHFFFAOYSA-N 3314 COC1=C(C=CC(=C1)CC=C)O Monomolecular Yes Primary 14.889 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Geraniol 106-24-1 GLZPCOQZEFWAFX-JXMROGBWSA-N 637566 CC(=CCC/C(=C/CO)/C)C Monomolecular Yes Primary 21 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers Yes Dose-Response 35.286 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3,7,11-Trimethyldodeca-1,6,10-trien-3-ol 142-50-7 FQTLCLSUCSAZDY-UHFFFAOYSA-N 8888 CC(=CCCC(=CCCC(C)(C=C)O)C)C Sum of Isomers No Primary 14.286 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3,7,11,15-Tetramethyl-2-hexadecen-1-OL 7541-49-3 BOTWFXYSPFMFNR-HMMYKYKNSA-N 5366244 CC(C)CCCC(C)CCCC(C)CCC/C(=C/CO)/C Sum of Isomers No Primary 6 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Thymol 89-83-8 MGSRCZKZVOBKFT-UHFFFAOYSA-N 6989 CC1=CC(=C(C=C1)C(C)C)O Monomolecular No Primary 6.571 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Farnesol 4602-84-0 CRDAMVZIKSXKFV-YFVJMOTDSA-N 445070 CC(=CCC/C(=C/CC/C(=C/CO)/C)/C)C Monomolecular No Primary 8.571 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular Yes Dose-Response 38.412 Spikes/s Raw 100 µg 17 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Ethyl 2,4-decadienoate, (2E,4Z)- 3025-30-7 OPCRGEVPIBLWAY-QNRZBPGKSA-N 5281162 CCCCC/C=C\C=C\C(=O)OCC Monomolecular No Primary 7.143 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Salicylate 119-36-8 OSWPMRLSEDHDFF-UHFFFAOYSA-N 4133 COC(=O)C1=CC=CC=C1O Monomolecular Yes Secondary 24.111 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular Yes Dose-Response 43 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (-)-Methyl jasmonate 1211-29-6 GEWDNTWNSAZUDX-WQMVXFAESA-N 5281929 CC/C=C\C[C@@H]1[C@H](CCC1=O)CC(=O)OC Monomolecular No Primary 11.143 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular Yes Dose-Response 37.786 Spikes/s Raw 100 µg 14 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular Yes Primary 29.667 Spikes/s Raw 100 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Indanone 83-33-0 QNXSIUBBGPHDDE-UHFFFAOYSA-N 6735 C1CC(=O)C2=CC=CC=C21 Monomolecular No Primary 10 Spikes/s Raw 100 µg 7 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular Yes Dose-Response 46.45 Spikes/s Raw 100 µg 20 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Prodlure 50767-79-8 RFEQLTBBKNKGGJ-DEQVHDEQSA-N 6441057 CC/C=C/C=C\CCCCCCCCOC(=O)C Monomolecular No Primary 11 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (Z,E)-9,12-Tetradecadienyl acetate 30507-70-1 ZZGJZGSVLNSDPG-FDTUMDBZSA-N 5365642 C/C=C/C/C=C\CCCCCCCCOC(=O)C Monomolecular No Primary 9.333 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (Z)-7-dodecenyl acetate 14959-86-5 MUZGQHWTRUVFLG-SREVYHEPSA-N 5363527 CCCC/C=C\CCCCCCOC(=O)C Monomolecular No Primary 7.333 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... (Z)-9-Tetradecenyl acetate 16725-53-4 XXPBOEBNDHAAQH-SREVYHEPSA-N 5364714 CCCC/C=C\CCCCCCCCOC(=O)C Monomolecular No Primary 8.667 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Myristoleyl alcohol 35153-15-2 GSAAJQNJNPBBSX-WAYWQWQTSA-N 5364712 CCCC/C=C\CCCCCCCCO Monomolecular Yes Primary 11.333 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Myristyl Acetate 638-59-5 IOUUIFSIQMVYKP-UHFFFAOYSA-N 12531 CCCCCCCCCCCCCCOC(=O)C Monomolecular No Primary 9.333 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 11-Tetradecenyl acetate, (11Z)- 20711-10-8 YJINQJFQLQIYHX-PLNGDYQASA-N 5367692 CC/C=C\CCCCCCCCCCOC(=O)C Monomolecular No Primary 8.333 Spikes/s Raw 10 µg 6 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 11-Tetradecenyl acetate, (11E)- 33189-72-9 YJINQJFQLQIYHX-SNAWJCMRSA-N 5367650 CC/C=C/CCCCCCCCCCOC(=O)C Monomolecular No Primary 10.8 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Carene 13466-78-9 BQOFWKZOCNGFEC-UHFFFAOYSA-N 26049 CC1=CCC2C(C1)C2(C)C Sum of Isomers No Dose-Response 4 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Carene 13466-78-9 BQOFWKZOCNGFEC-UHFFFAOYSA-N 26049 CC1=CCC2C(C1)C2(C)C Sum of Isomers No Dose-Response 13.4 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Carene 13466-78-9 BQOFWKZOCNGFEC-UHFFFAOYSA-N 26049 CC1=CCC2C(C1)C2(C)C Sum of Isomers Yes Dose-Response 21.4 Spikes/s Raw 10 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... alpha-Pinene, (+)- 7785-70-8 GRWFGVWFFZKLTI-RKDXNWHRSA-N 82227 CC1=CC[C@@H]2C[C@H]1C2(C)C Monomolecular No Dose-Response 3.4 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... alpha-Pinene, (+)- 7785-70-8 GRWFGVWFFZKLTI-RKDXNWHRSA-N 82227 CC1=CC[C@@H]2C[C@H]1C2(C)C Monomolecular No Dose-Response 9.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3a Or22a-GAL4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference
References Versions How To Documentation
M2iOR v1.0.0 · 2026-09-29   All Rights Reserved.