54
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
| Or35 | CAB3509398 | 100.00 | Spodoptera littoralis | MWNKIRKFGLDYCDLPTMIWNVAVFLKVLT ... | ||
| Or35 | CAB3509398 | 99.02 | Spodoptera littoralis | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... |
Results
Showing 31 to 60 of 85 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Estragole | 140-67-0 | ZFMSMUAANRJZFM-UHFFFAOYSA-N | 8815 | COC1=CC=C(C=C1)CC=C | Monomolecular | Yes | Dose-Response | 48.714 Spikes/s | Raw | 100 µg | 14 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Eugenol | 97-53-0 | RRAFCDWBNXTKKO-UHFFFAOYSA-N | 3314 | COC1=C(C=CC(=C1)CC=C)O | Monomolecular | Yes | Primary | 14.889 Spikes/s | Raw | 100 µg | 9 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Geraniol | 106-24-1 | GLZPCOQZEFWAFX-JXMROGBWSA-N | 637566 | CC(=CCC/C(=C/CO)/C)C | Monomolecular | Yes | Primary | 21 Spikes/s | Raw | 100 µg | 9 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Linalool | 78-70-6 | CDOSHBSSFJOMGT-UHFFFAOYSA-N | 6549 | CC(=CCCC(C)(C=C)O)C | Sum of Isomers | Yes | Dose-Response | 35.286 Spikes/s | Raw | 100 µg | 14 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3,7,11-Trimethyldodeca-1,6,10-trien-3-ol | 142-50-7 | FQTLCLSUCSAZDY-UHFFFAOYSA-N | 8888 | CC(=CCCC(=CCCC(C)(C=C)O)C)C | Sum of Isomers | No | Primary | 14.286 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3,7,11,15-Tetramethyl-2-hexadecen-1-OL | 7541-49-3 | BOTWFXYSPFMFNR-HMMYKYKNSA-N | 5366244 | CC(C)CCCC(C)CCCC(C)CCC/C(=C/CO)/C | Sum of Isomers | No | Primary | 6 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Thymol | 89-83-8 | MGSRCZKZVOBKFT-UHFFFAOYSA-N | 6989 | CC1=CC(=C(C=C1)C(C)C)O | Monomolecular | No | Primary | 6.571 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Farnesol | 4602-84-0 | CRDAMVZIKSXKFV-YFVJMOTDSA-N | 445070 | CC(=CCC/C(=C/CC/C(=C/CO)/C)/C)C | Monomolecular | No | Primary | 8.571 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | cis-3-HEXENYL ACETATE | 3681-71-8 | NPFVOOAXDOBMCE-PLNGDYQASA-N | 5363388 | CC/C=C\CCOC(=O)C | Monomolecular | Yes | Dose-Response | 38.412 Spikes/s | Raw | 100 µg | 17 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl 2,4-decadienoate, (2E,4Z)- | 3025-30-7 | OPCRGEVPIBLWAY-QNRZBPGKSA-N | 5281162 | CCCCC/C=C\C=C\C(=O)OCC | Monomolecular | No | Primary | 7.143 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Salicylate | 119-36-8 | OSWPMRLSEDHDFF-UHFFFAOYSA-N | 4133 | COC(=O)C1=CC=CC=C1O | Monomolecular | Yes | Secondary | 24.111 Spikes/s | Raw | 100 µg | 9 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Benzoate | 93-58-3 | QPJVMBTYPHYUOC-UHFFFAOYSA-N | 7150 | COC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 43 Spikes/s | Raw | 100 µg | 14 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (-)-Methyl jasmonate | 1211-29-6 | GEWDNTWNSAZUDX-WQMVXFAESA-N | 5281929 | CC/C=C\C[C@@H]1[C@H](CCC1=O)CC(=O)OC | Monomolecular | No | Primary | 11.143 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl methyl ether | 538-86-3 | GQKZBCPTCWJTAS-UHFFFAOYSA-N | 10869 | COCC1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 37.786 Spikes/s | Raw | 100 µg | 14 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Primary | 29.667 Spikes/s | Raw | 100 µg | 9 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Primary | 10 Spikes/s | Raw | 100 µg | 7 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 6-Methyl-5-hepten-2-one | 110-93-0 | UHEPJGULSIKKTP-UHFFFAOYSA-N | 9862 | CC(=CCCC(=O)C)C | Monomolecular | Yes | Dose-Response | 46.45 Spikes/s | Raw | 100 µg | 20 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Prodlure | 50767-79-8 | RFEQLTBBKNKGGJ-DEQVHDEQSA-N | 6441057 | CC/C=C/C=C\CCCCCCCCOC(=O)C | Monomolecular | No | Primary | 11 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (Z,E)-9,12-Tetradecadienyl acetate | 30507-70-1 | ZZGJZGSVLNSDPG-FDTUMDBZSA-N | 5365642 | C/C=C/C/C=C\CCCCCCCCOC(=O)C | Monomolecular | No | Primary | 9.333 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (Z)-7-dodecenyl acetate | 14959-86-5 | MUZGQHWTRUVFLG-SREVYHEPSA-N | 5363527 | CCCC/C=C\CCCCCCOC(=O)C | Monomolecular | No | Primary | 7.333 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (Z)-9-Tetradecenyl acetate | 16725-53-4 | XXPBOEBNDHAAQH-SREVYHEPSA-N | 5364714 | CCCC/C=C\CCCCCCCCOC(=O)C | Monomolecular | No | Primary | 8.667 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Myristoleyl alcohol | 35153-15-2 | GSAAJQNJNPBBSX-WAYWQWQTSA-N | 5364712 | CCCC/C=C\CCCCCCCCO | Monomolecular | Yes | Primary | 11.333 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Myristyl Acetate | 638-59-5 | IOUUIFSIQMVYKP-UHFFFAOYSA-N | 12531 | CCCCCCCCCCCCCCOC(=O)C | Monomolecular | No | Primary | 9.333 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 11-Tetradecenyl acetate, (11Z)- | 20711-10-8 | YJINQJFQLQIYHX-PLNGDYQASA-N | 5367692 | CC/C=C\CCCCCCCCCCOC(=O)C | Monomolecular | No | Primary | 8.333 Spikes/s | Raw | 10 µg | 6 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 11-Tetradecenyl acetate, (11E)- | 33189-72-9 | YJINQJFQLQIYHX-SNAWJCMRSA-N | 5367650 | CC/C=C/CCCCCCCCCCOC(=O)C | Monomolecular | No | Primary | 10.8 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Carene | 13466-78-9 | BQOFWKZOCNGFEC-UHFFFAOYSA-N | 26049 | CC1=CCC2C(C1)C2(C)C | Sum of Isomers | No | Dose-Response | 4 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Carene | 13466-78-9 | BQOFWKZOCNGFEC-UHFFFAOYSA-N | 26049 | CC1=CCC2C(C1)C2(C)C | Sum of Isomers | No | Dose-Response | 13.4 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Carene | 13466-78-9 | BQOFWKZOCNGFEC-UHFFFAOYSA-N | 26049 | CC1=CCC2C(C1)C2(C)C | Sum of Isomers | Yes | Dose-Response | 21.4 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | alpha-Pinene, (+)- | 7785-70-8 | GRWFGVWFFZKLTI-RKDXNWHRSA-N | 82227 | CC1=CC[C@@H]2C[C@H]1C2(C)C | Monomolecular | No | Dose-Response | 3.4 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | alpha-Pinene, (+)- | 7785-70-8 | GRWFGVWFFZKLTI-RKDXNWHRSA-N | 82227 | CC1=CC[C@@H]2C[C@H]1C2(C)C | Monomolecular | No | Dose-Response | 9.6 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3a | Or22a-GAL4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |