New Database Available - Released on 11/08/2026.
84
Unique InChIKey
14
Unique Receptor Sequence
2
Unique Co-Receptor Sequence
37
EC50 Parameter
4
Unique DOI
Receptor Name
Accession
Identity (%)
Species
Mutations
Sequence
Orco ref|XP_081832551.1| 99.79 Ips typographus M1L MEQKLISEEDLMNKFKVAGLVADLMPNIRL ...
Orco ref|XP_081832551.1| 100.00 Ips typographus - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...
Showing 151 to 180 of 701 results
 
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 3,7-Octadien-2-ol, 2-methyl-6-methylene-, (E)- 6994-89-4 NOEQSPUVXRMJBW-SOFGYWHQSA-N 5363351 CC(C)(/C=C/CC(=C)C=C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 4-Thujanol 17699-16-0 KXSDPILWMGFJMM-AEJSXWLSSA-N 6326181 CC(C)[C@@]12CC[C@@]([C@@H]1C2)(C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Grandisol 26532-22-9 SJKPJXGGNKMRPD-VHSXEESVSA-N 169202 CC(=C)[C@@H]1CC[C@]1(C)CCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 6,10-Dimethylundeca-5,9-Dien-2-One 689-67-8 HNZUNIKWNYHEJJ-UHFFFAOYSA-N 19633 CC(=CCCC(=CCCC(=O)C)C)C Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (1R,2R,5S)-2,6,6-trimethylbicyclo[3.1.1]heptan-3-one 473-62-1 MQPHVIPKLRXGDJ-GJMOJQLCSA-N 10329459 C[C@@H]1[C@H]2C[C@H](C2(C)C)CC1=O Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 1,8-Cineole 470-82-6 WEEGYLXZBRQIMU-UHFFFAOYSA-N 2758 CC1(C2CCC(O1)(CC2)C)C Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Isophorone 78-59-1 HJOVHMDZYOCNQW-UHFFFAOYSA-N 6544 CC1=CC(=O)CC(C1)(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Lanierone 28750-52-9 GKOBUKITZSFCJC-UHFFFAOYSA-N 642486 CC1=CC(C=C(C1=O)O)(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-3-buten-2-ol 115-18-4 HNVRRHSXBLFLIG-UHFFFAOYSA-N 8257 CC(C)(C=C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... alpha-Pinene, (+)- 7785-70-8 GRWFGVWFFZKLTI-RKDXNWHRSA-N 82227 CC1=CC[C@@H]2C[C@H]1C2(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Myrcene 123-35-3 UAHWPYUMFXYFJY-UHFFFAOYSA-N 31253 CC(=CCCC(=C)C=C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... P-Cymene 99-87-6 HFPZCAJZSCWRBC-UHFFFAOYSA-N 7463 CC1=CC=C(C=C1)C(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (+)-3-Carene 498-15-7 BQOFWKZOCNGFEC-BDAKNGLRSA-N 443156 CC1=CC[C@@H]2[C@H](C1)C2(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 3-Octanol 589-98-0 NMRPBPVERJPACX-UHFFFAOYSA-N 11527 CCCCCC(CC)O Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 1-Octen-3-Ol 3391-86-4 VSMOENVRRABVKN-UHFFFAOYSA-N 18827 CCCCCC(C=C)O Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 1-Hexanol 111-27-3 ZSIAUFGUXNUGDI-UHFFFAOYSA-N 8103 CCCCCCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Ethanol 64-17-5 LFQSCWFLJHTTHZ-UHFFFAOYSA-N 702 CCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane 68108-90-7 XNNASGSBOJGKAZ-IUCAKERBSA-N 155085 C[C@H]1CCC[C@]2(O1)CCCO2 Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Phenylethanol 1960-12-08 WRMNZCZEMHIOCP-UHFFFAOYSA-N 6054 C1=CC=C(C=C1)CCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Styrene 100-42-5 PPBRXRYQALVLMV-UHFFFAOYSA-N 7501 C=CC1=CC=CC=C1 Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 4-Methoxystyrene 637-69-4 UAJRSHJHFRVGMG-UHFFFAOYSA-N 12507 COC1=CC=C(C=C1)C=C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 3,4-Dimethoxytoluene 494-99-5 GYPMBQZAVBFUIZ-UHFFFAOYSA-N 68126 CC1=CC(=C(C=C1)OC)OC Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Methyleugenol 93-15-2 ZYEMGPIYFIJGTP-UHFFFAOYSA-N 7127 COC1=C(C=C(C=C1)CC=C)OC Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 4-Ethylguaiacol 2785-89-9 CHWNEIVBYREQRF-UHFFFAOYSA-N 62465 CCC1=CC(=C(C=C1)O)OC Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or28 A0A8F3IXZ3 - MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (Z)-2-Methyl-6-methylene-2,7-octadien-1-ol 17015-29-1 IEVYLQISZQFFGA-JXMROGBWSA-N 5319723 C/C(=C\CCC(=C)C=C)/CO Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or28 A0A8F3IXZ3 - MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-methylthioadenosine triphosphate tetrasodium 43170-89-4 XNOBOKJVOTYSJV-UHFFFAOYSA-N 1582 CSC1=NC(=C2C(=N1)N(C=N2)C3C(C(C(O3)COP(= ... Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or28 A0A8F3IXZ3 - MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 6,8-dioxabicyclo[3.2.1]octane, 1,5-dimethyl- 60478-96-8 AZWKCIZRVUVZPX-UHFFFAOYSA-N 34235 CC12CCCC(O1)(OC2)C Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or28 A0A8F3IXZ3 - MGLYPASRYFKNPIMWSSILGAFPWQMIFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Ipsdienol 35628-00-3 NHMKYUHMPXBMFI-SNVBAGLBSA-N 92301 CC(=C[C@H](CC(=C)C=C)O)C Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference