Or36 | M2iOR

65

Unique InChIKey

1

Unique Receptor Sequence

1

Unique Co-Receptor Sequence

0

EC50 Parameter

1

Unique DOI

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Or36	WZI48883.1	100.00	Ips typographus		MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...

Showing 61 to 66 of 66 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Styrene	100-42-5	PPBRXRYQALVLMV-UHFFFAOYSA-N	7501	C=CC1=CC=CC=C1	Monomolecular	No	Primary	0.536 %Δ fluorescence	Norm. other	30 µM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Benzaldehyde	100-52-7	HUMNYLRZRPPJDN-UHFFFAOYSA-N	240	C1=CC=C(C=C1)C=O	Monomolecular	No	Primary	0.694 %Δ fluorescence	Norm. other	30 µM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Benzyl acetate	140-11-4	QUKGYYKBILRGFE-UHFFFAOYSA-N	8785	CC(=O)OCC1=CC=CC=C1	Monomolecular	No	Primary	0.28 %Δ fluorescence	Norm. other	30 µM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Acetophenone	98-86-2	KWOLFJPFCHCOCG-UHFFFAOYSA-N	7410	CC(=O)C1=CC=CC=C1	Monomolecular	No	Primary	0.954 %Δ fluorescence	Norm. other	30 µM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Dihydrobenzofuran	496-16-2	HBEDSQVIWPRPAY-UHFFFAOYSA-N	10329	C1COC2=CC=CC=C21	Monomolecular	No	Primary	0.006 %Δ fluorescence	Norm. other	30 µM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.
Ips typographus	Or36	WZI48883.1	-	MASDEFIKIPKIFLILGGFWPFSVTKDPLK ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Lanierone	28750-52-9	GKOBUKITZSFCJC-UHFFFAOYSA-N	642486	CC1=CC(C=C(C1=O)O)(C)C	Monomolecular	Yes	Dose-Response	32.787 %Δ fluorescence	Norm. other	790 nM	9	Calcium Imaging	CLARIOstar Omega plate reader (BMG Labtech)	∆ Fluorescence	Hek	HEK293	pcDNATM4/TO	Liquid	N.A.	N.A.	N.A.	Yuvaraj, J. K., Kandasamy, D., ...	10.1186/s12915-024-02066-x	N.A.

« Previous
Next »

Showing 61 to 66 of 66 results

‹
1
2
3