511
Unique InChIKey
212
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
241
EC50 Parameter
18
Unique DOI
BLAST (Receptor variants)
| Orco | Q9VNB5 | 100.00 | Drosophila melanogaster | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Results
Showing 1561 to 1590 of 23940 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 24 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 56.8 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 121.125 Spikes/s | Raw | 100 µg | 16 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | No | Dose-Response | 4.2 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | No | Dose-Response | 3 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 9.4 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 21.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 48.6 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 102.938 Spikes/s | Raw | 100 µg | 16 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 12.6 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 18.2 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 24.2 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 38.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 74.4 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzyl Alcohol | 100-51-6 | WVDDGKGOMKODPV-UHFFFAOYSA-N | 244 | C1=CC=C(C=C1)CO | Monomolecular | Yes | Dose-Response | 132.25 Spikes/s | Raw | 100 µg | 16 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 9.2 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 8.6 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 8 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 6.6 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 16.4 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | Yes | Dose-Response | 55 Spikes/s | Raw | 100 µg | 17 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl Acetate | 141-78-6 | XEKOWRVHYACXOJ-UHFFFAOYSA-N | 8857 | CCOC(=O)C | Monomolecular | No | Primary | 2.778 Spikes/s | Raw | 0.1 µg | 9 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl hexanoate | 123-66-0 | SHZIWNPUGXLXDT-UHFFFAOYSA-N | 31265 | CCCCCC(=O)OCC | Monomolecular | No | Primary | 3.1 Spikes/s | Raw | 0.1 µg | 10 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Heptanone | 110-43-0 | CATSNJVOTSVZJV-UHFFFAOYSA-N | 8051 | CCCCCC(=O)C | Monomolecular | Yes | Primary | 9.167 Spikes/s | Raw | 0.1 µg | 12 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Heptanol | 111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | No | Dose-Response | 2.667 Spikes/s | Raw | 0.1 µg | 3 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Heptanol | 111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | No | Dose-Response | 3.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Heptanol | 111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | Yes | Dose-Response | 21.4 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Heptanol | 111-70-6 | BBMCTIGTTCKYKF-UHFFFAOYSA-N | 8129 | CCCCCCCO | Monomolecular | Yes | Dose-Response | 56.267 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | cis-3-HEXENYL ACETATE | 3681-71-8 | NPFVOOAXDOBMCE-PLNGDYQASA-N | 5363388 | CC/C=C\CCOC(=O)C | Monomolecular | No | Dose-Response | 3.4 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | cis-3-HEXENYL ACETATE | 3681-71-8 | NPFVOOAXDOBMCE-PLNGDYQASA-N | 5363388 | CC/C=C\CCOC(=O)C | Monomolecular | Yes | Dose-Response | 6.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |