M2OR : Database of Olfactory Receptors-Molecule Measurments

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Orco	Q9VNB5	100.00	Drosophila melanogaster		MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...

Showing 1321 to 1350 of 23940 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	Yes	Secondary	19.5 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Primary	16.5 Spikes/s	Raw	100 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Octanol	111-87-5	KBPLFHHGFOOTCA-UHFFFAOYSA-N	957	CCCCCCCCO	Monomolecular	No	Primary	5.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Nonanol	143-08-8	ZWRUINPWMLAQRD-UHFFFAOYSA-N	8914	CCCCCCCCCO	Monomolecular	No	Primary	3.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Benzyl Alcohol	100-51-6	WVDDGKGOMKODPV-UHFFFAOYSA-N	244	C1=CC=C(C=C1)CO	Monomolecular	No	Primary	2.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Carvacrol	499-75-2	RECUKUPTGUEGMW-UHFFFAOYSA-N	10364	CC1=C(C=C(C=C1)C(C)C)O	Monomolecular	No	Primary	1 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Estragole	140-67-0	ZFMSMUAANRJZFM-UHFFFAOYSA-N	8815	COC1=CC=C(C=C1)CC=C	Monomolecular	No	Primary	2.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Eugenol	97-53-0	RRAFCDWBNXTKKO-UHFFFAOYSA-N	3314	COC1=C(C=CC(=C1)CC=C)O	Monomolecular	No	Primary	2.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Geraniol	106-24-1	GLZPCOQZEFWAFX-JXMROGBWSA-N	637566	CC(=CCC/C(=C/CO)/C)C	Monomolecular	No	Primary	3 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Linalool	78-70-6	CDOSHBSSFJOMGT-UHFFFAOYSA-N	6549	CC(=CCCC(C)(C=C)O)C	Sum of Isomers	No	Primary	2.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	3,7,11-Trimethyldodeca-1,6,10-trien-3-ol	142-50-7	FQTLCLSUCSAZDY-UHFFFAOYSA-N	8888	CC(=CCCC(=CCCC(C)(C=C)O)C)C	Sum of Isomers	No	Primary	4.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	3,7,11,15-tetramethyl-2-hexadecen-1-ol	7541-49-3	BOTWFXYSPFMFNR-HMMYKYKNSA-N	5366244	CC(C)CCCC(C)CCCC(C)CCC/C(=C/CO)/C	Sum of Isomers	No	Primary	2.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Thymol	89-83-8	MGSRCZKZVOBKFT-UHFFFAOYSA-N	6989	CC1=CC(=C(C=C1)C(C)C)O	Monomolecular	No	Primary	1.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Farnesol	4602-84-0	CRDAMVZIKSXKFV-YFVJMOTDSA-N	445070	CC(=CCC/C(=C/CC/C(=C/CO)/C)/C)C	Monomolecular	No	Primary	1.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	cis-3-HEXENYL ACETATE	3681-71-8	NPFVOOAXDOBMCE-PLNGDYQASA-N	5363388	CC/C=C\CCOC(=O)C	Monomolecular	No	Primary	2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Ethyl 2,4-decadienoate, (2E,4Z)-	3025-30-7	OPCRGEVPIBLWAY-QNRZBPGKSA-N	5281162	CCCCC/C=C\C=C\C(=O)OCC	Monomolecular	No	Primary	7 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	Yes	Dose-Response	93.182 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Benzoate	93-58-3	QPJVMBTYPHYUOC-UHFFFAOYSA-N	7150	COC(=O)C1=CC=CC=C1	Monomolecular	Yes	Dose-Response	71.182 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(-)-methyl jasmonate	1211-29-6	GEWDNTWNSAZUDX-WQMVXFAESA-N	5281929	CC/C=C\C[C@@H]1[C@H](CCC1=O)CC(=O)OC	Monomolecular	No	Primary	2.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Benzyl methyl ether	538-86-3	GQKZBCPTCWJTAS-UHFFFAOYSA-N	10869	COCC1=CC=CC=C1	Monomolecular	No	Primary	3.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Acetophenone	98-86-2	KWOLFJPFCHCOCG-UHFFFAOYSA-N	7410	CC(=O)C1=CC=CC=C1	Monomolecular	Yes	Secondary	34.727 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	No	Primary	14.727 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	6-Methyl-5-hepten-2-one	110-93-0	UHEPJGULSIKKTP-UHFFFAOYSA-N	9862	CC(=CCCC(=O)C)C	Monomolecular	No	Primary	8.909 Spikes/s	Raw	100 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Prodlure	50767-79-8	RFEQLTBBKNKGGJ-DEQVHDEQSA-N	6441057	CC/C=C/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	3.2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z,E)-9,12-tetradecadienyl acetate	30507-70-1	ZZGJZGSVLNSDPG-FDTUMDBZSA-N	5365642	C/C=C/C/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	3.2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z)-7-dodecenyl acetate	14959-86-5	MUZGQHWTRUVFLG-SREVYHEPSA-N	5363527	CCCC/C=C\CCCCCCOC(=O)C	Monomolecular	No	Primary	5 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z)-9-tetradecenyl acetate	16725-53-4	XXPBOEBNDHAAQH-SREVYHEPSA-N	5364714	CCCC/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myristoleyl alcohol	35153-15-2	GSAAJQNJNPBBSX-WAYWQWQTSA-N	5364712	CCCC/C=C\CCCCCCCCO	Monomolecular	No	Primary	2.2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myristyl acetate	638-59-5	IOUUIFSIQMVYKP-UHFFFAOYSA-N	12531	CCCCCCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	3.2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(11Z)-11-tetradecenyl acetate	20711-10-8	YJINQJFQLQIYHX-PLNGDYQASA-N	5367692	CC/C=C\CCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	5.2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.