M2OR : Database of Olfactory Receptors-Molecule Measurments

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Orco	Q9VNB5	100.00	Drosophila melanogaster		MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...

Showing 1471 to 1500 of 23940 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(-)-methyl jasmonate	1211-29-6	GEWDNTWNSAZUDX-WQMVXFAESA-N	5281929	CC/C=C\C[C@@H]1[C@H](CCC1=O)CC(=O)OC	Monomolecular	No	Primary	2.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Benzyl methyl ether	538-86-3	GQKZBCPTCWJTAS-UHFFFAOYSA-N	10869	COCC1=CC=CC=C1	Monomolecular	No	Primary	3 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Acetophenone	98-86-2	KWOLFJPFCHCOCG-UHFFFAOYSA-N	7410	CC(=O)C1=CC=CC=C1	Monomolecular	No	Primary	2.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-indanone	83-33-0	QNXSIUBBGPHDDE-UHFFFAOYSA-N	6735	C1CC(=O)C2=CC=CC=C21	Monomolecular	No	Primary	4.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	6-Methyl-5-hepten-2-one	110-93-0	UHEPJGULSIKKTP-UHFFFAOYSA-N	9862	CC(=CCCC(=O)C)C	Monomolecular	No	Primary	6.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Prodlure	50767-79-8	RFEQLTBBKNKGGJ-DEQVHDEQSA-N	6441057	CC/C=C/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	2.4 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z,E)-9,12-tetradecadienyl acetate	30507-70-1	ZZGJZGSVLNSDPG-FDTUMDBZSA-N	5365642	C/C=C/C/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	2.6 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z)-7-dodecenyl acetate	14959-86-5	MUZGQHWTRUVFLG-SREVYHEPSA-N	5363527	CCCC/C=C\CCCCCCOC(=O)C	Monomolecular	No	Primary	1.8 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z)-9-tetradecenyl acetate	16725-53-4	XXPBOEBNDHAAQH-SREVYHEPSA-N	5364714	CCCC/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	1.8 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myristoleyl alcohol	35153-15-2	GSAAJQNJNPBBSX-WAYWQWQTSA-N	5364712	CCCC/C=C\CCCCCCCCO	Monomolecular	No	Primary	3.8 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myristyl acetate	638-59-5	IOUUIFSIQMVYKP-UHFFFAOYSA-N	12531	CCCCCCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(11Z)-11-tetradecenyl acetate	20711-10-8	YJINQJFQLQIYHX-PLNGDYQASA-N	5367692	CC/C=C\CCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(11E)-11-tetradecenyl acetate	33189-72-9	YJINQJFQLQIYHX-SNAWJCMRSA-N	5367650	CC/C=C/CCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	3.2 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	No	Secondary	3 Spikes/s	Raw	0.1 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or21	emb\|CAB3516994.1\|	E2D · K9R · V41D · I...	MDNFSGSYRQTKTTEFLINLNKFIFVFGLP ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Ethyl Acetate	141-78-6	XEKOWRVHYACXOJ-UHFFFAOYSA-N	8857	CCOC(=O)C	Monomolecular	No	Primary	2.333 Spikes/s	Raw	0.1 µg	3	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Ethyl Acetate	141-78-6	XEKOWRVHYACXOJ-UHFFFAOYSA-N	8857	CCOC(=O)C	Monomolecular	No	Primary	6.091 Spikes/s	Raw	0.1 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Ethyl hexanoate	123-66-0	SHZIWNPUGXLXDT-UHFFFAOYSA-N	31265	CCCCCC(=O)OCC	Monomolecular	No	Primary	4.636 Spikes/s	Raw	0.1 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	2-Heptanone	110-43-0	CATSNJVOTSVZJV-UHFFFAOYSA-N	8051	CCCCCC(=O)C	Monomolecular	Yes	Primary	11.636 Spikes/s	Raw	0.1 µg	11	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Humulene	6753-98-6	FAMPSKZZVDUYOS-HRGUGZIWSA-N	5281520	C/C/1=C\CC(/C=C/C/C(=C/CC1)/C)(C)C	Monomolecular	No	Primary	7.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(-)-Caryophyllene	87-44-5	NPNUFJAVOOONJE-GFUGXAQUSA-N	5281515	C/C/1=C\CCC(=C)[C@H]2CC([C@@H]2CC1)(C)C	Monomolecular	No	Primary	7.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	3-Carene	13466-78-9	BQOFWKZOCNGFEC-UHFFFAOYSA-N	26049	CC1=CCC2C(C1)C2(C)C	Sum of Isomers	No	Primary	4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Copaene	3856-25-5	VLXDPFLIRFYIME-BTFPBAQTSA-N	12303902	CC1=CC[C@H]2[C@H]3[C@@H]1[C@@]2(CC[C@H]3 ...	Monomolecular	No	Primary	5.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Farnesene	502-61-4	CXENHBSYCFFKJS-VDQVFBMKSA-N	5281516	CC(=CCC/C(=C/C/C=C(\C)/C=C)/C)C	Monomolecular	No	Primary	4.8 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	alpha-Pinene, (+)-	7785-70-8	GRWFGVWFFZKLTI-RKDXNWHRSA-N	82227	CC1=CC[C@@H]2C[C@H]1C2(C)C	Monomolecular	No	Primary	4.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Beta-Pinene	127-91-3	WTARULDDTDQWMU-UHFFFAOYSA-N	14896	CC1(C2CCC(=C)C1C2)C	Sum of Isomers	No	Primary	3.6 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myrcene	123-35-3	UAHWPYUMFXYFJY-UHFFFAOYSA-N	31253	CC(=CCCC(=C)C=C)C	Monomolecular	No	Primary	4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	beta-OCIMENE, (3E)-	3779-61-1	IHPKGUQCSIINRJ-CSKARUKUSA-N	5281553	CC(=CC/C=C(\C)/C=C)C	Monomolecular	No	Primary	4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Indole	120-72-9	SIKJAQJRHWYJAI-UHFFFAOYSA-N	798	C1=CC=C2C(=C1)C=CN2	Monomolecular	No	Primary	2.4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(3E)-4,8-dimethyl-1,3,7-nonatriene	19945-61-0	LUKZREJJLWEWQM-YRNVUSSQSA-N	6427110	CC(=CCC/C(=C/C=C)/C)C	Monomolecular	No	Primary	4 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or22	emb\|CAB3517122.1\|	S261P · K413C · R415...	MRLQIIKDFLMKASFDFDRPDIDLYNFHPQ ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(E,E)-4,8,12-Trimethyl-1,3,7,11-tridecatetraene	62235-06-7	CWLVBFJCJXHUCF-RNPYNJAESA-N	6443227	CC(=CCC/C(=C/CC/C(=C/C=C)/C)/C)C	Monomolecular	No	Primary	3.2 Spikes/s	Raw	100 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.