9-hydroxy-2E-decenoic acid | M2iOR

New Database Available - Released on 29/09/2026.

|

|

About Us Contact Us How To Documentation

9-hydroxy-2E-decenoic acid

CID: 5312739

InChIKey: DZBLNYYGAKHAOJ-SOFGYWHQSA-N

SMILES: CC(CCCCC/C=C/C(=O)O)O

Mixture: Sum of Isomers

1

Unique InChIKey

2

Unique Receptor Sequence

1

Unique Co-Receptor Sequence

0

EC50 Parameter

1

Unique DOI

Showing 1 to 2 of 2 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Apis mellifera	Or109	A0A7M6UWX9	-	MDERAIEDQYLKINKFFGQLVGVWPYQKKF ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	9-hydroxy-2E-decenoic acid (E)-9-Hydroxy-2-decenoic acid	4448-33-3	DZBLNYYGAKHAOJ-SOFGYWHQSA-N	5312739	CC(CCCCC/C=C/C(=O)O)O	Sum of Isomers	No	Primary	1.428 %	Norm. other	100 µg/µL	20	Calcium Imaging	Olympus BX51WI	∆ Fluorescence	Drosophila	ab3A	N.A.	Airborne Paper	500 mL/min	3 L/min	1 s	Andreu, B., Mariette, J., Dela ...	10.1038/s42003-025-09391-z	Fig1 + Annex1a
Apis mellifera	Or136	A0A7M7M5T4	-	MNVFDKHYHTYRTLMKIVGLWPYNNSIYVW ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	9-hydroxy-2E-decenoic acid (E)-9-Hydroxy-2-decenoic acid	4448-33-3	DZBLNYYGAKHAOJ-SOFGYWHQSA-N	5312739	CC(CCCCC/C=C/C(=O)O)O	Sum of Isomers	Yes	Primary	2.499 %	Norm. other	100 µg/µL	12	Calcium Imaging	Olympus BX51WI	∆ Fluorescence	Drosophila	ab3A	N.A.	Airborne Paper	500 mL/min	3 L/min	1 s	Andreu, B., Mariette, J., Dela ...	10.1038/s42003-025-09391-z	Fig1 + Annex1b