New Database Available - Released on 29/09/2026.
|
|
About Us Contact Us How To Documentation
About Us Contact Us How To Documentation
1
Unique InChIKey
180
Unique Receptor Sequence
10
Unique Co-Receptor Sequence
25
EC50 Parameter
18
Unique DOI
Results
Showing 181 to 202 of 202 results
 
10
30
50
100
150
Species
Name
Mutated
Species
Name
Mutated
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Drosophila melanogaster Or98a Q9VAZ3 - MLFNYLRKPNPTNLLTSPDSFRYFEYGMFC ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers Yes Primary 140 Spikes/s Norm. receptor 0.01 V/V 6 Single Sensillum Recording tungsten electrode SSR Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 5.9 mL/s 24 mL/s N.A. Hallem, E. A., & Carlson, J. R ... 10.1016/j.cell.2006.01.050 Table S1
Bactrocera minax Or12 A0A6H1V5Y2 - MILENEEEIYKRNYNSSKVLFRVSFALGVN ... Bactrocera minax Orco A0A3G2LEL3 - MQPSKYVGLVADLMPNIRLMKYSGLFMHNF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary N.A. N.A. 1.000e-4 M 6 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus oocytes N.A. N.A. Liquid N.A. N.A. N.A. Liu, Y., Cui, Z., Wang, G., Zh ... 10.3389/fphys.2020.00246 Figure 5
Bactrocera minax Or16 A0A6N0A5X5 - MTPLFKSSETAPTVPDFVGIPLFLIKFMGG ... Bactrocera minax Orco A0A3G2LEL3 - MQPSKYVGLVADLMPNIRLMKYSGLFMHNF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary N.A. N.A. 1.000e-4 M 6 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus oocytes N.A. N.A. Liquid N.A. N.A. N.A. Liu, Y., Cui, Z., Wang, G., Zh ... 10.3389/fphys.2020.00246 Figure 5
Bactrocera minax Or5 A0A7S5WLV1 - MAYWAIATRKGQSPPMKITPVLNPNQREFL ... Bactrocera minax Orco A0A3G2LEL3 - MQPSKYVGLVADLMPNIRLMKYSGLFMHNF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary N.A. N.A. 1.000e-4 M 6 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus oocytes N.A. N.A. Liquid N.A. N.A. N.A. Liu, Y., Cui, Z., Wang, G., Zh ... 10.3389/fphys.2020.00246 Figure 4
Plutella xylostella Or11 UUS54180.1 - MQLLSSIWRKLTQTRALEYSSGSYETQFFE ... Plutella xylostella Orco D0EZE1 - MMNKVKAQGLVSDLMPNIKLMQMAGHFLFN ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary N.A. Raw 1.000e-4 M 6 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus oocytes N.A. pT7T Liquid N.A. N.A. N.A. Liu, Y., Zhang, S., Liu, Y., & ... 10.3389/fphys.2022.938555 Figure 4
Spodoptera frugiperda Or40 A0A9R0D2T2 - MEELPDISEEFIEPILPCLSLLRNAHILIY ... Spodoptera frugiperda Orco A0A9F1UC78 - MMTKVKAQGLVSDLMPNIKLMQAAGHFLFN ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 1.000e-4 M 7 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus oocytes N.A. pT7Ts Liquid N.A. N.A. N.A. Wang, Z., Wang, X., Liu, W., C ... 10.3390/insects15080564 Table S1 ; Figure 4
Culex quinquefasciatus Or136 KM229537.1 - MTQFTSRAVQTVKKWLKVKCSEMKQNCKNL ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Figure 3
Culex quinquefasciatus Or55 KM229536.1 - MTLLKKLNSYKIFRHSHTEPNELYDSLIVV ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Main text
Culex quinquefasciatus Or64 KM229532.1 - MEYLRKISQLKVFRHSYKDPSDFYNHVLVM ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Main text
Culex quinquefasciatus Or93 KM229533.1 - MVNYLTRLRSAYARFVDIRNADDIFSHYVW ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Main text
Culex quinquefasciatus Or125 KM229531.1 - MELKDEWIHEDDVYSNPLLRLTLNGLKYYG ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Main text
Culex quinquefasciatus Or132 KM229535.1 - MATYLDRLKAGYHRFVDIRKTGDLFGHYIW ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Main text
Culex quinquefasciatus Or151 KM229534.1 - MEHFRKVPAVVRASKVQVLNRVRWLWEDLP ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 200 nA Raw 0.001 M 4 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Xu, P., Choo, Y.-M., De La Ros ... 10.1073/pnas.1417244111 Main text
Aedes albopictus Or11 XP_029717479.2 I233V · M249L · S379... MQLKDEWIQEDDVYDNPLLRLTINGLKYYG ... Aedes albopictus Orco XP_029733114.1 - MNVQPTKYHGLVLDLMPNIRLMQGFGHFLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary < 300 nA Raw 1.000e-4 M 8 Two-electrode Voltage Clamp Manual Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Yan, R., Xu, Z., Qian, J., Zho ... 10.1186/s13071-022-05158-1 Figure 2
Culex quinquefasciatus Or4 MG280965.1 - MKSHSPLNCMAVMPFTLRCVKLFGFRGGLH ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure 1
Culex quinquefasciatus Or5 MG280966.1 - MKFYELREPMAAVPFILRVLRFSGLLGCPR ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers Yes Primary 67 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure 3
Culex quinquefasciatus Or5 MG280966.1 - MKFYELREPMAAVPFILRVLRFSGLLGCPR ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers Yes Dose-Response 574 nM EC50 N.A. 9 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure 4
Culex quinquefasciatus Or2 MG280964.1 - MRFAPLQDRMAVMPFTLRCLRLFGLRGDRR ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure S2
Culex quinquefasciatus Or84 MN227015.1 - MEFLAAQDPFEAMPFLKKVLSTTGLGWPQR ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure S2
Aedes aegypti Or14 MN227017.1 - MNYFELVEPEAVMPLALRLLETYGLRGEKR ... Aedes aegypti Orco NP_001345400.1 - MNVQPTKYHGLVLDLMPNIRLMQGFGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure S2
Aedes aegypti Or15 MN227018.1 - MKYFELTEPEAAMPLALRLLETYGLRGGKR ... Aedes aegypti Orco NP_001345400.1 - MNVQPTKYHGLVLDLMPNIRLMQGFGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Figure 5
Culex quinquefasciatus Or85 MN227016.1 - MEFLAAQDPFEAMPFLKKVLTVTGLGWPRR ... Culex quinquefasciatus Orco XP_038118600.1 - MNVQPTKYQGLVADLMPNIRLMQGVGHFLF ... Linalool
(+-)-Linalool 		78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Primary 0 nA Raw 0.001 M 3 Two-electrode Voltage Clamp OC-725C Current Amplitude Xenopus oocytes N.A. Kozak driver Liquid N.A. N.A. N.A. Zeng, F., Xu, P., & Leal, W. S ... 10.1016/j.ibmb.2019.103213 Main text
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference
References Versions How To Documentation
M2iOR v1.0.0 · 2026-09-29   All Rights Reserved.