New Database Available - Released on 02/10/2026.
|
|
About Us Contact Us How To Documentation
About Us Contact Us How To Documentation
761
Unique InChIKey
337
Unique Receptor Sequence
23
Unique Co-Receptor Sequence
1113
EC50 Parameter
41
Unique DOI
Results
Showing 35341 to 35370 of 35891 results
 
10
30
50
100
150
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Phenylacetaldehyde
2-phenylacetaldehyde 		122-78-1 DTUQWGWMVIHBKE-UHFFFAOYSA-N 998 C1=CC=C(C=C1)CC=O Monomolecular No Dose-Response 2.75 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Phenylacetaldehyde
2-phenylacetaldehyde 		122-78-1 DTUQWGWMVIHBKE-UHFFFAOYSA-N 998 C1=CC=C(C=C1)CC=O Monomolecular Yes Dose-Response 11.625 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Hexanol 111-27-3 ZSIAUFGUXNUGDI-UHFFFAOYSA-N 8103 CCCCCCO Monomolecular No Dose-Response 0.125 Spikes/s Raw 0.1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Hexanol 111-27-3 ZSIAUFGUXNUGDI-UHFFFAOYSA-N 8103 CCCCCCO Monomolecular No Dose-Response 0.625 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Hexanol 111-27-3 ZSIAUFGUXNUGDI-UHFFFAOYSA-N 8103 CCCCCCO Monomolecular No Dose-Response 10.875 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Heptanol
1-Heptanol 		111-70-6 BBMCTIGTTCKYKF-UHFFFAOYSA-N 8129 CCCCCCCO Monomolecular No Dose-Response 3 Spikes/s Raw 0.1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Heptanol
1-Heptanol 		111-70-6 BBMCTIGTTCKYKF-UHFFFAOYSA-N 8129 CCCCCCCO Monomolecular No Dose-Response 2.125 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Heptanol
1-Heptanol 		111-70-6 BBMCTIGTTCKYKF-UHFFFAOYSA-N 8129 CCCCCCCO Monomolecular No Dose-Response 6 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Dose-Response 0.125 Spikes/s Raw 1.000e-4 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Dose-Response 1.375 Spikes/s Raw 0.001 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Dose-Response 2 Spikes/s Raw 0.01 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Dose-Response 2.625 Spikes/s Raw 0.1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Dose-Response 1.375 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl Alcohol 100-51-6 WVDDGKGOMKODPV-UHFFFAOYSA-N 244 C1=CC=C(C=C1)CO Monomolecular No Dose-Response 11.125 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 3.125 Spikes/s Raw 0.1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 2.25 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 7.375 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 1.75 Spikes/s Raw 1.000e-4 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 1.25 Spikes/s Raw 0.001 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 1.125 Spikes/s Raw 0.01 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 3.125 Spikes/s Raw 0.1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 9.625 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 17.5 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Indanone 83-33-0 QNXSIUBBGPHDDE-UHFFFAOYSA-N 6735 C1CC(=O)C2=CC=CC=C21 Monomolecular No Dose-Response 2 Spikes/s Raw 0.1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Indanone 83-33-0 QNXSIUBBGPHDDE-UHFFFAOYSA-N 6735 C1CC(=O)C2=CC=CC=C21 Monomolecular No Dose-Response 0.75 Spikes/s Raw 1 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or27 CAB3507814 - MIILNENMKTKLAFLSPVVPYGVFESWEDL ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 1-Indanone 83-33-0 QNXSIUBBGPHDDE-UHFFFAOYSA-N 6735 C1CC(=O)C2=CC=CC=C21 Monomolecular No Dose-Response 5.25 Spikes/s Raw 10 µg 4 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or28 ABQ84982 - MTSLYRKFLFKKKLKQRIDERVYNKRDYDA ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE
(Z)-3-hexenyl acetate 		3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular Yes Dose-Response 83.538 Spikes/s Raw 100 µg 13 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or28 ABQ84982 - MTSLYRKFLFKKKLKQRIDERVYNKRDYDA ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Ethyl Acetate 141-78-6 XEKOWRVHYACXOJ-UHFFFAOYSA-N 8857 CCOC(=O)C Monomolecular No Primary 17.444 Spikes/s Raw 0.1 µg 9 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or28 ABQ84982 - MTSLYRKFLFKKKLKQRIDERVYNKRDYDA ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Ethyl hexanoate 123-66-0 SHZIWNPUGXLXDT-UHFFFAOYSA-N 31265 CCCCCC(=O)OCC Monomolecular No Primary 12.964 Spikes/s Raw 0.1 µg 28 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Spodoptera littoralis Or28 ABQ84982 - MTSLYRKFLFKKKLKQRIDERVYNKRDYDA ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 2-Heptanone 110-43-0 CATSNJVOTSVZJV-UHFFFAOYSA-N 8051 CCCCCC(=O)C Monomolecular No Primary 11.71 Spikes/s Raw 0.1 µg 31 Single Sensillum Recording tungsten electrode Spiking Frequency Drosophila ab3A Or22a-Gal4 Airborne Paper 0.6 L/min 1.5 L/min 500 ms de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 reanalysis of raw data
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference
References Versions How To Documentation
M2iOR v1.0.2 · 2026-10-02   All Rights Reserved.