54
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
| Or27 | CAB3507814 | 100.00 | Spodoptera littoralis | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... |
Results
Showing 91 to 97 of 97 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Dose-Response | 1.125 Spikes/s | Raw | 0.01 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Dose-Response | 3.125 Spikes/s | Raw | 0.1 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Dose-Response | 9.625 Spikes/s | Raw | 1 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Acetophenone | 98-86-2 | KWOLFJPFCHCOCG-UHFFFAOYSA-N | 7410 | CC(=O)C1=CC=CC=C1 | Monomolecular | No | Dose-Response | 17.5 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Dose-Response | 2 Spikes/s | Raw | 0.1 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Dose-Response | 0.75 Spikes/s | Raw | 1 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or27 | CAB3507814 | - | MIILNENMKTKLAFLSPVVPYGVFESWEDL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-indanone | 83-33-0 | QNXSIUBBGPHDDE-UHFFFAOYSA-N | 6735 | C1CC(=O)C2=CC=CC=C21 | Monomolecular | No | Dose-Response | 5.25 Spikes/s | Raw | 10 µg | 4 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |