54
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
| Or24 | CAB3517108 | 100.00 | Spodoptera littoralis | MGLIKNLCLKLSYTKAIDRSSGRLETIFFE ... | ||
| Or24 | CAB3517108 | 99.15 | Spodoptera littoralis | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... |
Results
Showing 1 to 30 of 96 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 5 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 5 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 5.2 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 6.4 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 18.6 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Benzaldehyde | 100-52-7 | HUMNYLRZRPPJDN-UHFFFAOYSA-N | 240 | C1=CC=C(C=C1)C=O | Monomolecular | Yes | Dose-Response | 54.647 Spikes/s | Raw | 100 µg | 17 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Phenylacetaldehyde | 122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 5.2 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Phenylacetaldehyde | 122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 5.4 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Phenylacetaldehyde | 122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 7.6 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Phenylacetaldehyde | 122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 6.8 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Phenylacetaldehyde | 122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 16.4 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Phenylacetaldehyde | 122-78-1 | DTUQWGWMVIHBKE-UHFFFAOYSA-N | 998 | C1=CC=C(C=C1)CC=O | Monomolecular | Yes | Dose-Response | 45.706 Spikes/s | Raw | 100 µg | 17 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Hexen-1-ol | 2305-21-7 | ZCHHRLHTBGRGOT-SNAWJCMRSA-N | 5318042 | CCC/C=C/CO | Monomolecular | Yes | Dose-Response | 7.2 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Hexen-1-ol | 2305-21-7 | ZCHHRLHTBGRGOT-SNAWJCMRSA-N | 5318042 | CCC/C=C/CO | Monomolecular | Yes | Dose-Response | 8.2 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Hexen-1-ol | 2305-21-7 | ZCHHRLHTBGRGOT-SNAWJCMRSA-N | 5318042 | CCC/C=C/CO | Monomolecular | Yes | Dose-Response | 12.6 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Hexen-1-ol | 2305-21-7 | ZCHHRLHTBGRGOT-SNAWJCMRSA-N | 5318042 | CCC/C=C/CO | Monomolecular | Yes | Dose-Response | 19.8 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Hexen-1-ol | 2305-21-7 | ZCHHRLHTBGRGOT-SNAWJCMRSA-N | 5318042 | CCC/C=C/CO | Monomolecular | Yes | Dose-Response | 49 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Hexen-1-ol | 2305-21-7 | ZCHHRLHTBGRGOT-SNAWJCMRSA-N | 5318042 | CCC/C=C/CO | Monomolecular | Yes | Dose-Response | 108.875 Spikes/s | Raw | 100 µg | 16 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | No | Dose-Response | 4.8 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 6.8 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 12.2 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 24 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 56.8 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | Yes | Dose-Response | 121.125 Spikes/s | Raw | 100 µg | 16 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | No | Dose-Response | 4.2 Spikes/s | Raw | 0.001 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | No | Dose-Response | 3 Spikes/s | Raw | 0.01 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 9.4 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 21.2 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 48.6 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |
| Spodoptera littoralis | Or24 | CAB3517108 | V307L · N380S | MRVLSHVWRRISQSKALELAGPLETAFFAS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | Yes | Dose-Response | 102.938 Spikes/s | Raw | 100 µg | 16 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | N.A. |