Or17 | M2iOR

54

Unique InChIKey

1

Unique Receptor Sequence

1

Unique Co-Receptor Sequence

0

EC50 Parameter

1

Unique DOI

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Or17	CAB3510392	100.00	Spodoptera littoralis		MDKLSQVMFVLLCHVTCVAKQVAFHVDADR ...
	Or17	CAB3510392	99.69	Spodoptera littoralis	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...

Showing 61 to 72 of 72 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	No	Secondary	3.8 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	No	Secondary	3.4 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	No	Dose-Response	3.25 Spikes/s	Raw	0.001 µg	4	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	No	Dose-Response	8 Spikes/s	Raw	0.01 µg	4	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	Yes	Dose-Response	21.5 Spikes/s	Raw	0.1 µg	4	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	Yes	Dose-Response	37.8 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	Yes	Dose-Response	63.8 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Benzoate	93-58-3	QPJVMBTYPHYUOC-UHFFFAOYSA-N	7150	COC(=O)C1=CC=CC=C1	Monomolecular	No	Dose-Response	1.75 Spikes/s	Raw	0.1 µg	4	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Benzoate	93-58-3	QPJVMBTYPHYUOC-UHFFFAOYSA-N	7150	COC(=O)C1=CC=CC=C1	Monomolecular	No	Dose-Response	5.8 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Benzoate	93-58-3	QPJVMBTYPHYUOC-UHFFFAOYSA-N	7150	COC(=O)C1=CC=CC=C1	Monomolecular	Yes	Dose-Response	15 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Acetophenone	98-86-2	KWOLFJPFCHCOCG-UHFFFAOYSA-N	7410	CC(=O)C1=CC=CC=C1	Monomolecular	No	Secondary	6.6 Spikes/s	Raw	1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or17	CAB3510392	D190E	MSVCAGSVAPHVRCLRRVGFCRWGAAAPAN ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Acetophenone	98-86-2	KWOLFJPFCHCOCG-UHFFFAOYSA-N	7410	CC(=O)C1=CC=CC=C1	Monomolecular	Yes	Secondary	16 Spikes/s	Raw	10 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.

« Previous
Next »

Showing 61 to 72 of 72 results

‹
1
2
3