202
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
| Or6 | A0A0M3SBN7 | 100.00 | Locusta migratoria | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... |
Results
Showing 1 to 30 of 205 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2,6-Dimethylcyclohexanol | 5337-72-4 | MOISVRZIQDQVPF-UHFFFAOYSA-N | 21428 | CC1CCCC(C1O)C | Sum of Isomers | No | Primary | 10.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Penten-1-ol | 20273-24-9 | BTSIZIIPFNVMHF-ONEGZZNKSA-N | 5364920 | CC/C=C/CO | Monomolecular | No | Primary | 9.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Hexenol | 928-96-1 | UFLHIIWVXFIJGU-ARJAWSKDSA-N | 5281167 | CC/C=C\CCO | Monomolecular | No | Primary | 4.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Nonen-1-ol, (3Z)- | 10340-23-5 | IFTBJDZSLBRRMC-SREVYHEPSA-N | 5364631 | CCCCC/C=C\CCO | Monomolecular | No | Primary | 1.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 4-Ethylguaiacol | 2785-89-9 | CHWNEIVBYREQRF-UHFFFAOYSA-N | 62465 | CCC1=CC(=C(C=C1)O)OC | Monomolecular | No | Primary | 7.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Hexadecane | 544-76-3 | DCAYPVUWAIABOU-UHFFFAOYSA-N | 11006 | CCCCCCCCCCCCCCCC | Monomolecular | No | Primary | 4.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Phenylethanol | 1960-12-08 | WRMNZCZEMHIOCP-UHFFFAOYSA-N | 6054 | C1=CC=C(C=C1)CCO | Monomolecular | No | Primary | 8.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Veratrole | 91-16-7 | ABDKAPXRBAPSQN-UHFFFAOYSA-N | 7043 | COC1=CC=CC=C1OC | Monomolecular | No | Primary | 9.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (+)-Cyclosativene | 22469-52-9 | XBWACJDEQIZTPR-VMTXFGJYSA-N | 138394132 | CC(C)[C@@H]1CC[C@]2([C@H]3[C@@H]1C4C2([C ... | Sum of Isomers | No | Primary | 10.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Linalool | 78-70-6 | CDOSHBSSFJOMGT-UHFFFAOYSA-N | 6549 | CC(=CCCC(C)(C=C)O)C | Sum of Isomers | No | Primary | 9.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | trans-2-Hexenal | 6728-26-3 | MBDOYVRWFFCFHM-SNAWJCMRSA-N | 5281168 | CCC/C=C/C=O | Monomolecular | No | Primary | 8.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2-Octen-1-ol, (2E)- | 18409-17-1 | AYQPVPFZWIQERS-VOTSOKGWSA-N | 5318599 | CCCCC/C=C/CO | Monomolecular | No | Primary | 19.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 2,4-Heptadienal | 5910-85-0 | SATICYYAWWYRAM-VNKDHWASSA-N | 5283321 | CC/C=C/C=C/C=O | Monomolecular | No | Primary | -0.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (2E)-Decenal | 3913-81-3 | MMFCJPPRCYDLLZ-CMDGGOBGSA-N | 5283345 | CCCCCCC/C=C/C=O | Monomolecular | No | Primary | 1 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Oleamide | 301-02-0 | FATBGEAMYMYZAF-KTKRTIGZSA-N | 5283387 | CCCCCCCC/C=C\CCCCCCCC(=O)N | Monomolecular | No | Primary | 2.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Linoleic Acid | 60-33-3 | OYHQOLUKZRVURQ-HZJYTTRNSA-N | 5280450 | CCCCC/C=C\C/C=C\CCCCCCCC(=O)O | Monomolecular | No | Primary | 2.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1,2,4-Trimethoxybenzene | 135-77-3 | AGIQIOSHSMJYJP-UHFFFAOYSA-N | 67284 | COC1=CC(=C(C=C1)OC)OC | Monomolecular | No | Primary | 5.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1,3-Dimethyluracil | 874-14-6 | JSDBKAHWADVXFU-UHFFFAOYSA-N | 70122 | CN1C=CC(=O)N(C1=O)C | Monomolecular | No | Primary | 6.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1,4-Dimethoxybenzene | 150-78-7 | OHBQPCCCRFSCAX-UHFFFAOYSA-N | 9016 | COC1=CC=C(C=C1)OC | Monomolecular | No | Primary | 27.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Acetylcyclohexene | 932-66-1 | LTYLUDGDHUEBGX-UHFFFAOYSA-N | 13612 | CC(=O)C1=CCCCC1 | Monomolecular | No | Primary | 4.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | n-Butoxy-2-propanol | 5131-66-8 | RWNUSVWFHDHRCJ-UHFFFAOYSA-N | 21210 | CCCCOCC(C)O | Sum of Isomers | No | Primary | 3.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Dodecanol | 112-53-8 | LQZZUXJYWNFBMV-UHFFFAOYSA-N | 8193 | CCCCCCCCCCCCO | Monomolecular | No | Primary | 7.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Cetyl Alcohol | 36653-82-4 | BXWNKGSJHAJOGX-UHFFFAOYSA-N | 2682 | CCCCCCCCCCCCCCCCO | Monomolecular | No | Primary | 12.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Hexanol | 111-27-3 | ZSIAUFGUXNUGDI-UHFFFAOYSA-N | 8103 | CCCCCCO | Monomolecular | No | Primary | 16.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Methylcycloheptan-1-ol | 3761-94-2 | XFFKAYOHINCUNU-UHFFFAOYSA-N | 77376 | CC1(CCCCCC1)O | Monomolecular | No | Primary | 4.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Nonanol | 143-08-8 | ZWRUINPWMLAQRD-UHFFFAOYSA-N | 8914 | CCCCCCCCCO | Monomolecular | No | Primary | 7.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Octanol | 111-87-5 | KBPLFHHGFOOTCA-UHFFFAOYSA-N | 957 | CCCCCCCCO | Monomolecular | No | Primary | 0.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Octen-3-Ol | 3391-86-4 | VSMOENVRRABVKN-UHFFFAOYSA-N | 18827 | CCCCCC(C=C)O | Sum of Isomers | No | Primary | 9.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Pentadecanal | 2765-11-9 | XGQJZNCFDLXSIJ-UHFFFAOYSA-N | 17697 | CCCCCCCCCCCCCCC=O | Monomolecular | No | Primary | 8.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Pentanol | 71-41-0 | AMQJEAYHLZJPGS-UHFFFAOYSA-N | 6276 | CCCCCO | Monomolecular | No | Primary | 12.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |