202
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
BLAST (Receptor variants)
| Or6 | A0A0M3SBN7 | 100.00 | Locusta migratoria | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... |
Results
Showing 151 to 180 of 205 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Isoborneol | 124-76-5 | DTGKSKDOIYIVQL-MRTMQBJTSA-N | 6321405 | C[C@@]12CC[C@@H](C1(C)C)C[C@H]2O | Monomolecular | No | Primary | 11.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Isophorone | 78-59-1 | HJOVHMDZYOCNQW-UHFFFAOYSA-N | 6544 | CC1=CC(=O)CC(C1)(C)C | Monomolecular | Yes | Primary | 9.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Isophthalaldehyde | 626-19-7 | IZALUMVGBVKPJD-UHFFFAOYSA-N | 34777 | C1=CC(=CC(=C1)C=O)C=O | Monomolecular | No | Primary | 10.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Methyl-3-buten-1-ol | 763-32-6 | CPJRRXSHAYUTGL-UHFFFAOYSA-N | 12988 | CC(=C)CCO | Monomolecular | No | Primary | 21.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 1-Methyl-4-Prop-1-En-2-Ylcyclohexene | 138-86-3 | XMGQYMWWDOXHJM-UHFFFAOYSA-N | 22311 | CC1=CCC(CC1)C(=C)C | Sum of Isomers | No | Primary | 5.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Linalool, oxide | 1365-19-1 | BRHDDEIRQPDPMG-UHFFFAOYSA-N | 22310 | CC1(CCC(O1)C(C)(C)O)C=C | Sum of Isomers | No | Primary | 6.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Alpha-Terpineol | 98-55-5 | WUOACPNHFRMFPN-UHFFFAOYSA-N | 17100 | CC1=CCC(CC1)C(C)(C)O | Sum of Isomers | No | Primary | 6.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | M-Cresol | 108-39-4 | RLSSMJSEOOYNOY-UHFFFAOYSA-N | 342 | CC1=CC(=CC=C1)O | Monomolecular | No | Primary | 16.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | M-Cymene | 535-77-3 | XCYJPXQACVEIOS-UHFFFAOYSA-N | 10812 | CC1=CC(=CC=C1)C(C)C | Monomolecular | No | Primary | 0.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Benzoate | 93-58-3 | QPJVMBTYPHYUOC-UHFFFAOYSA-N | 7150 | COC(=O)C1=CC=CC=C1 | Monomolecular | No | Primary | 1.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl hexanoate | 106-70-7 | NUKZAGXMHTUAFE-UHFFFAOYSA-N | 7824 | CCCCCC(=O)OC | Monomolecular | No | Primary | 2.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Oleate | 112-62-9 | QYDYPVFESGNLHU-KHPPLWFESA-N | 5364509 | CCCCCCCC/C=C\CCCCCCCC(=O)OC | Monomolecular | No | Primary | 7.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Salicylate | 119-36-8 | OSWPMRLSEDHDFF-UHFFFAOYSA-N | 4133 | COC(=O)C1=CC=CC=C1O | Monomolecular | No | Primary | 10.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl Stearate | 112-61-8 | HPEUJPJOZXNMSJ-UHFFFAOYSA-N | 8201 | CCCCCCCCCCCCCCCCCC(=O)OC | Monomolecular | No | Primary | -0.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Methyl 2,4-Dihydroxybenzoate | 2150-47-2 | IIFCLXHRIYTHPV-UHFFFAOYSA-N | 16523 | COC(=O)C1=C(C=C(C=C1)O)O | Monomolecular | No | Primary | -0.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 3-Methoxytoluene | 100-84-5 | OSIGJGFTADMDOB-UHFFFAOYSA-N | 7530 | CC1=CC(=CC=C1)OC | Monomolecular | No | Primary | 4.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Musk ketone | 81-14-1 | WXCMHFPAUCOJIG-UHFFFAOYSA-N | 6669 | CC1=C(C(=C(C(=C1[N+](=O)[O-])C(C)(C)C)[N ... | Monomolecular | No | Primary | 3.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Neophytadiene | 504-96-1 | NIDGCIPAMWNKOA-UHFFFAOYSA-N | 10446 | CC(C)CCCC(C)CCCC(C)CCCC(=C)C=C | Sum of Isomers | No | Primary | -1.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Nerolidol | 7212-44-4 | FQTLCLSUCSAZDY-SDNWHVSQSA-N | 5284507 | CC(=CCC/C(=C/CCC(C)(C=C)O)/C)C | Sum of Isomers | No | Primary | 6.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | N-Ethylmaleimide | 128-53-0 | HDFGOPSGAURCEO-UHFFFAOYSA-N | 4362 | CCN1C(=O)C=CC1=O | Monomolecular | No | Primary | 3 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Palmitic Acid | 57-10-3 | IPCSVZSSVZVIGE-UHFFFAOYSA-N | 985 | CCCCCCCCCCCCCCCC(=O)O | Monomolecular | No | Primary | 5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | N-Methylbenzamide | 613-93-4 | NCCHARWOCKOHIH-UHFFFAOYSA-N | 11954 | CNC(=O)C1=CC=CC=C1 | Monomolecular | No | Primary | 7.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Nonanal | 124-19-6 | GYHFUZHODSMOHU-UHFFFAOYSA-N | 31289 | CCCCCCCCC=O | Monomolecular | No | Primary | 5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Nonane | 111-84-2 | BKIMMITUMNQMOS-UHFFFAOYSA-N | 8141 | CCCCCCCCC | Monomolecular | No | Primary | 1.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Nonanoic Acid | 112-05-0 | FBUKVWPVBMHYJY-UHFFFAOYSA-N | 8158 | CCCCCCCCC(=O)O | Monomolecular | No | Primary | 2.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | O-Cresol | 95-48-7 | QWVGKYWNOKOFNN-UHFFFAOYSA-N | 335 | CC1=CC=CC=C1O | Monomolecular | No | Primary | 4.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Octacosane | 630-02-4 | ZYURHZPYMFLWSH-UHFFFAOYSA-N | 12408 | CCCCCCCCCCCCCCCCCCCCCCCCCCCC | Monomolecular | No | Primary | 2.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Octadecane | 593-45-3 | RZJRJXONCZWCBN-UHFFFAOYSA-N | 11635 | CCCCCCCCCCCCCCCCCC | Monomolecular | No | Primary | 5.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl stearate | 111-61-5 | MVLVMROFTAUDAG-UHFFFAOYSA-N | 8122 | CCCCCCCCCCCCCCCCCC(=O)OCC | Monomolecular | No | Primary | 1.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Octane | 111-65-9 | TVMXDCGIABBOFY-UHFFFAOYSA-N | 356 | CCCCCCCC | Monomolecular | No | Primary | 4.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |