New Database Available - Released on 11/08/2026.
|
About Us Contact Us How To Documentation
About Us Contact Us How To Documentation
511
Unique InChIKey
212
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
241
EC50 Parameter
18
Unique DOI
BLAST (Receptor variants)
Receptor Name
Accession
Identity (%)
Species
Mutations
Sequence
Orco Q9VNB5 100.00 Drosophila melanogaster MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...
Results
Showing 2311 to 2340 of 23940 results
 
10
30
50
100
150
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
–
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Indole 120-72-9 SIKJAQJRHWYJAI-UHFFFAOYSA-N 798 C1=CC=C2C(=C1)C=CN2 Monomolecular Yes Dose-Response 23.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol 928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular No Dose-Response 0.8 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol 928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular No Dose-Response 2.4 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 3-Hexenol 928-96-1 UFLHIIWVXFIJGU-ARJAWSKDSA-N 5281167 CC/C=C\CCO Monomolecular No Dose-Response 6.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular No Dose-Response 1.6 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular No Dose-Response 4 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular Yes Dose-Response 16 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Dose-Response 2.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Dose-Response 3.4 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Linalool 78-70-6 CDOSHBSSFJOMGT-UHFFFAOYSA-N 6549 CC(=CCCC(C)(C=C)O)C Sum of Isomers No Dose-Response 13 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular No Dose-Response 1.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular No Dose-Response 2 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... cis-3-HEXENYL ACETATE 3681-71-8 NPFVOOAXDOBMCE-PLNGDYQASA-N 5363388 CC/C=C\CCOC(=O)C Monomolecular No Dose-Response 10.6 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 1.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 2.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Methyl Benzoate 93-58-3 QPJVMBTYPHYUOC-UHFFFAOYSA-N 7150 COC(=O)C1=CC=CC=C1 Monomolecular No Dose-Response 14.4 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular No Dose-Response 2.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzyl methyl ether 538-86-3 GQKZBCPTCWJTAS-UHFFFAOYSA-N 10869 COCC1=CC=CC=C1 Monomolecular Yes Dose-Response 16.4 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular No Dose-Response 3 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular No Dose-Response 15 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or35 CAB3509398 D11E · N244D · D250_... MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 6-Methyl-5-hepten-2-one 110-93-0 UHEPJGULSIKKTP-UHFFFAOYSA-N 9862 CC(=CCCC(=O)C)C Monomolecular Yes Dose-Response 26.2 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular No Dose-Response 6 Spikes/s Raw 0.001 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular No Dose-Response 7 Spikes/s Raw 0.01 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular No Dose-Response 7.2 Spikes/s Raw 0.1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular No Dose-Response 7.6 Spikes/s Raw 1 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular Yes Dose-Response 15 Spikes/s Raw 10 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... Benzaldehyde 100-52-7 HUMNYLRZRPPJDN-UHFFFAOYSA-N 240 C1=CC=C(C=C1)C=O Monomolecular Yes Dose-Response 28.235 Spikes/s Raw 100 µg 17 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 2-Hexen-1-ol 2305-21-7 ZCHHRLHTBGRGOT-SNAWJCMRSA-N 5318042 CCC/C=C/CO Monomolecular No Dose-Response 7.4 Spikes/s Raw 0.001 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Spodoptera littoralis Or36 CAB3509397 Y110C · T136S MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... Drosophila melanogaster Orco Q9VNB5 - MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... 2-Hexen-1-ol 2305-21-7 ZCHHRLHTBGRGOT-SNAWJCMRSA-N 5318042 CCC/C=C/CO Monomolecular No Dose-Response 7 Spikes/s Raw 0.01 µg 5 Single Sensillum Recording N.A. Spiking Frequency Drosophila N.A. pUAS Airstream 6 mL/s N.A. 1 s de Fouchier, A., Walker, W. B. ... 10.1038/ncomms15709 N.A.
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
–
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference
References How To Documentation
All Rights Reserved.