511
Unique InChIKey
212
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
241
EC50 Parameter
18
Unique DOI
BLAST (Receptor variants)
| Orco | Q9VNB5 | 100.00 | Drosophila melanogaster | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... |
Results
Showing 3181 to 3210 of 23940 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Catechol | 120-80-9 | YCIMNLLNPGFGHC-UHFFFAOYSA-N | 289 | C1=CC=C(C(=C1)O)O | Monomolecular | No | Primary | 6.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Cinnamaldehyde | 104-55-2 | KJPRLNWUNMBNBZ-QPJJXVBHSA-N | 637511 | C1=CC=C(C=C1)/C=C/C=O | Monomolecular | No | Primary | 4 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | beta-Farnesene, (6Z)- | 28973-97-9 | JSNRRGGBADWTMC-QINSGFPZSA-N | 5317319 | CC(=CCC/C(=C\CCC(=C)C=C)/C)C | Monomolecular | No | Primary | 13.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Citronellol | 106-22-9 | QMVPMAAFGQKVCJ-UHFFFAOYSA-N | 8842 | CC(CCC=C(C)C)CCO | Sum of Isomers | No | Primary | 10.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Dihydrobenzofuran | 496-16-2 | HBEDSQVIWPRPAY-UHFFFAOYSA-N | 10329 | C1COC2=CC=CC=C21 | Monomolecular | No | Primary | 6.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Cyclohexanol | 108-93-0 | HPXRVTGHNJAIIH-UHFFFAOYSA-N | 7966 | C1CCC(CC1)O | Monomolecular | No | Primary | 6 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Decanal | 112-31-2 | KSMVZQYAVGTKIV-UHFFFAOYSA-N | 8175 | CCCCCCCCCC=O | Monomolecular | No | Primary | -0.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Decane | 124-18-5 | DIOQZVSQGTUSAI-UHFFFAOYSA-N | 15600 | CCCCCCCCCC | Monomolecular | No | Primary | 8.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Decanoic Acid | 334-48-5 | GHVNFZFCNZKVNT-UHFFFAOYSA-N | 2969 | CCCCCCCCCC(=O)O | Monomolecular | No | Primary | 9.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Diacetone Alcohol | 123-42-2 | SWXVUIWOUIDPGS-UHFFFAOYSA-N | 31256 | CC(=O)CC(C)(C)O | Monomolecular | No | Primary | 3.333 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | N,N-Dibutylformamide | 761-65-9 | NZMAJUHVSZBJHL-UHFFFAOYSA-N | 12975 | CCCCN(CCCC)C=O | Monomolecular | No | Primary | 1.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Dihydroactinidiolide | 17092-92-1 | IMKHDCBNRDRUEB-LLVKDONJSA-N | 6432173 | C[C@@]12CCCC(C1=CC(=O)O2)(C)C | Monomolecular | No | Primary | 4 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Dodecanal | 112-54-9 | HFJRKMMYBMWEAD-UHFFFAOYSA-N | 8194 | CCCCCCCCCCCC=O | Monomolecular | No | Primary | 3 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Dodecane | 112-40-3 | SNRUBQQJIBEYMU-UHFFFAOYSA-N | 8182 | CCCCCCCCCCCC | Monomolecular | No | Primary | 7.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Lauric Acid | 143-07-7 | POULHZVOKOAJMA-UHFFFAOYSA-N | 3893 | CCCCCCCCCCCC(=O)O | Monomolecular | No | Primary | 6.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl Dodecanoate | 106-33-2 | MMXKVMNBHPAILY-UHFFFAOYSA-N | 7800 | CCCCCCCCCCCC(=O)OCC | Monomolecular | No | Primary | 10.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl Dodecanoate | 106-33-2 | MMXKVMNBHPAILY-UHFFFAOYSA-N | 7800 | CCCCCCCCCCCC(=O)OCC | Monomolecular | No | Primary | 3.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | (2E)-3-Methyl-2-hexenoic acid | 27960-21-0 | NTWSIWWJPQHFTO-AATRIKPKSA-N | 6443739 | CCC/C(=C/C(=O)O)/C | Monomolecular | No | Primary | 2.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | 4-Ethylbenzaldehyde | 4748-78-1 | QNGNSVIICDLXHT-UHFFFAOYSA-N | 20861 | CCC1=CC=C(C=C1)C=O | Monomolecular | No | Primary | 1.667 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl Acetate | 141-78-6 | XEKOWRVHYACXOJ-UHFFFAOYSA-N | 8857 | CCOC(=O)C | Monomolecular | No | Primary | 2.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl Myristate | 124-06-1 | MMKRHZKQPFCLLS-UHFFFAOYSA-N | 31283 | CCCCCCCCCCCCCC(=O)OCC | Monomolecular | No | Primary | 6 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Ethyl palmitate | 628-97-7 | XIRNKXNNONJFQO-UHFFFAOYSA-N | 12366 | CCCCCCCCCCCCCCCC(=O)OCC | Monomolecular | No | Primary | 15.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Eugenol | 97-53-0 | RRAFCDWBNXTKKO-UHFFFAOYSA-N | 3314 | COC1=C(C=CC(=C1)CC=C)O | Monomolecular | No | Primary | 4.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Farnesene | 502-61-4 | CXENHBSYCFFKJS-VDQVFBMKSA-N | 5281516 | CC(=CCC/C(=C/C/C=C(\C)/C=C)/C)C | Monomolecular | No | Primary | 5.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Geranylacetone | 3796-70-1 | HNZUNIKWNYHEJJ-FMIVXFBMSA-N | 1549778 | CC(=CCC/C(=C/CCC(=O)C)/C)C | Monomolecular | No | Primary | 9.167 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Globulol | 489-41-8 | AYXPYQRXGNDJFU-QTPLKFIXSA-N | 12304985 | C[C@@H]1CC[C@@H]2[C@@H]1[C@H]3[C@H](C3(C ... | Monomolecular | No | Primary | 6.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Glycerol | 56-81-5 | PEDCQBHIVMGVHV-UHFFFAOYSA-N | 753 | C(C(CO)O)O | Monomolecular | No | Primary | 9 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Guaiacol | 90-05-1 | LHGVFZTZFXWLCP-UHFFFAOYSA-N | 460 | COC1=CC=CC=C1O | Monomolecular | No | Primary | 3.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Heptacosane | 593-49-7 | BJQWYEJQWHSSCJ-UHFFFAOYSA-N | 11636 | CCCCCCCCCCCCCCCCCCCCCCCCCCC | Monomolecular | No | Primary | 1.833 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |
| Locusta migratoria | Or6 | A0A0M3SBN7 | - | MDVSFAAVSVMRAGLPAEESGGNRRARRVT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Heptanal | 111-71-7 | FXHGMKSSBGDXIY-UHFFFAOYSA-N | 8130 | CCCCCCC=O | Monomolecular | No | Primary | 8.5 Spikes/s | Norm. receptor | N.A. | 6-8 | Single Sensillum Recording | N.A. | Spiking Frequency | Drosophila | N.A. | pUAS | Airstream | 6 mL/s | N.A. | 1 s | Chang, H., Unni, A. P., Tom, M ... | 10.1016/j.cub.2023.11.017 | N.A. |