M2OR : Database of Olfactory Receptors-Molecule Measurments

	Receptor Name	Accession	Identity (%)	Species	Mutations	Sequence
	Orco	Q9VNB5	100.00	Drosophila melanogaster		MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...

Showing 1771 to 1800 of 23940 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z,E)-9,12-tetradecadienyl acetate	30507-70-1	ZZGJZGSVLNSDPG-FDTUMDBZSA-N	5365642	C/C=C/C/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	1.167 Spikes/s	Raw	10 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z)-7-dodecenyl acetate	14959-86-5	MUZGQHWTRUVFLG-SREVYHEPSA-N	5363527	CCCC/C=C\CCCCCCOC(=O)C	Monomolecular	No	Primary	1 Spikes/s	Raw	10 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(Z)-9-tetradecenyl acetate	16725-53-4	XXPBOEBNDHAAQH-SREVYHEPSA-N	5364714	CCCC/C=C\CCCCCCCCOC(=O)C	Monomolecular	No	Primary	1.333 Spikes/s	Raw	10 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myristoleyl alcohol	35153-15-2	GSAAJQNJNPBBSX-WAYWQWQTSA-N	5364712	CCCC/C=C\CCCCCCCCO	Monomolecular	No	Primary	2.1 Spikes/s	Raw	10 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Myristyl acetate	638-59-5	IOUUIFSIQMVYKP-UHFFFAOYSA-N	12531	CCCCCCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	2.167 Spikes/s	Raw	10 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(11Z)-11-tetradecenyl acetate	20711-10-8	YJINQJFQLQIYHX-PLNGDYQASA-N	5367692	CC/C=C\CCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	2.333 Spikes/s	Raw	10 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(11E)-11-tetradecenyl acetate	33189-72-9	YJINQJFQLQIYHX-SNAWJCMRSA-N	5367650	CC/C=C/CCCCCCCCCCOC(=O)C	Monomolecular	No	Primary	1.167 Spikes/s	Raw	10 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Nonanal	124-19-6	GYHFUZHODSMOHU-UHFFFAOYSA-N	31289	CCCCCCCCC=O	Monomolecular	No	Dose-Response	0 Spikes/s	Raw	1 µg	10	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Nonanal	124-19-6	GYHFUZHODSMOHU-UHFFFAOYSA-N	31289	CCCCCCCCC=O	Monomolecular	No	Dose-Response	1.222 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(2E)-1-(6-bromo-2-methyl-4-phenylquinolin-3-yl)-3-(1,3-diphenyl-1H-pyrazol-4-yl)prop-2-en-1-one	6728‐26‐3	DRLWUIYQAYZENU-LVZFUZTISA-N	5291168	CC1=C(C(=C2C=C(C=CC2=N1)Br)C3=CC=CC=C3)C ...	Monomolecular	No	Dose-Response	0.333 Spikes/s	Raw	1 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(2E)-1-(6-bromo-2-methyl-4-phenylquinolin-3-yl)-3-(1,3-diphenyl-1H-pyrazol-4-yl)prop-2-en-1-one	6728‐26‐3	DRLWUIYQAYZENU-LVZFUZTISA-N	5291168	CC1=C(C(=C2C=C(C=CC2=N1)Br)C3=CC=CC=C3)C ...	Monomolecular	No	Dose-Response	1.333 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	Yes	Dose-Response	4.556 Spikes/s	Raw	1 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	Yes	Dose-Response	6.222 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	3.667 Spikes/s	Raw	1 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	Yes	Dose-Response	7.222 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	No	Dose-Response	2.778 Spikes/s	Raw	1 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	Yes	Dose-Response	3.778 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	6-Methyl-5-hepten-2-one	110-93-0	UHEPJGULSIKKTP-UHFFFAOYSA-N	9862	CC(=CCCC(=O)C)C	Monomolecular	No	Dose-Response	1.667 Spikes/s	Raw	1 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	6-Methyl-5-hepten-2-one	110-93-0	UHEPJGULSIKKTP-UHFFFAOYSA-N	9862	CC(=CCCC(=O)C)C	Monomolecular	Yes	Dose-Response	5.111 Spikes/s	Raw	10 µg	9	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Nonanal	124-19-6	GYHFUZHODSMOHU-UHFFFAOYSA-N	31289	CCCCCCCCC=O	Monomolecular	No	Dose-Response	1.2 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	(2E)-1-(6-bromo-2-methyl-4-phenylquinolin-3-yl)-3-(1,3-diphenyl-1H-pyrazol-4-yl)prop-2-en-1-one	6728‐26‐3	DRLWUIYQAYZENU-LVZFUZTISA-N	5291168	CC1=C(C(=C2C=C(C=CC2=N1)Br)C3=CC=CC=C3)C ...	Monomolecular	No	Dose-Response	0.6 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	No	Dose-Response	0.8 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Heptanol	111-70-6	BBMCTIGTTCKYKF-UHFFFAOYSA-N	8129	CCCCCCCO	Monomolecular	No	Dose-Response	2.2 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Methyl Salicylate	119-36-8	OSWPMRLSEDHDFF-UHFFFAOYSA-N	4133	COC(=O)C1=CC=CC=C1O	Monomolecular	No	Dose-Response	1.4 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or26	CAH1640018	Q271H · M281R · L292...	MSLSSGSVATHLRILRRCGYCRLAGGARVA ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	6-Methyl-5-hepten-2-one	110-93-0	UHEPJGULSIKKTP-UHFFFAOYSA-N	9862	CC(=CCCC(=O)C)C	Monomolecular	No	Dose-Response	0.6 Spikes/s	Raw	0.1 µg	5	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or27	CAB3507814	-	MIILNENMKTKLAFLSPVVPYGVFESWEDL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Indole	120-72-9	SIKJAQJRHWYJAI-UHFFFAOYSA-N	798	C1=CC=C2C(=C1)C=CN2	Monomolecular	Yes	Dose-Response	97.667 Spikes/s	Raw	100 µg	12	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or27	CAB3507814	-	MIILNENMKTKLAFLSPVVPYGVFESWEDL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Ethyl Acetate	141-78-6	XEKOWRVHYACXOJ-UHFFFAOYSA-N	8857	CCOC(=O)C	Monomolecular	No	Primary	4 Spikes/s	Raw	0.1 µg	17	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or27	CAB3507814	-	MIILNENMKTKLAFLSPVVPYGVFESWEDL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Ethyl hexanoate	123-66-0	SHZIWNPUGXLXDT-UHFFFAOYSA-N	31265	CCCCCC(=O)OCC	Monomolecular	No	Primary	6.147 Spikes/s	Raw	0.1 µg	17	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or27	CAB3507814	-	MIILNENMKTKLAFLSPVVPYGVFESWEDL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	2-Heptanone	110-43-0	CATSNJVOTSVZJV-UHFFFAOYSA-N	8051	CCCCCC(=O)C	Monomolecular	Yes	Primary	10.529 Spikes/s	Raw	0.1 µg	17	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.
Spodoptera littoralis	Or27	CAB3507814	-	MIILNENMKTKLAFLSPVVPYGVFESWEDL ...	Drosophila melanogaster	Orco	Q9VNB5	-	MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ...	Humulene	6753-98-6	FAMPSKZZVDUYOS-HRGUGZIWSA-N	5281520	C/C/1=C\CC(/C=C/C/C(=C/CC1)/C)(C)C	Monomolecular	No	Primary	3.667 Spikes/s	Raw	100 µg	6	Single Sensillum Recording	N.A.	Spiking Frequency	Drosophila	N.A.	pUAS	Airstream	6 mL/s	N.A.	1 s	de Fouchier, A., Walker, W. B. ...	10.1038/ncomms15709	N.A.