1
Unique InChIKey
1
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
1
EC50 Parameter
2
Unique DOI
BLAST (Receptor variants)
| Or4g | AHF20367.1 | 100.00 | Aedes aegypti | MTQSIEFEQTFGFIAKVLQMIGYPSCLAPY ... |
Results
Showing 1 to 2 of 2 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Aedes aegypti | Or4g | AHF20367.1 | - | MTQSIEFEQTFGFIAKVLQMIGYPSCLAPY ... | Aedes aegypti | Orco | NP_001345400.1 | - | MNVQPTKYHGLVLDLMPNIRLMQGFGHFLF ... | 6-Methyl-5-hepten-2-one | 110-93-0 | UHEPJGULSIKKTP-UHFFFAOYSA-N | 9862 | CC(=CCCC(=O)C)C | Monomolecular | Yes | Dose-Response | 102 µM | EC50 | N.A. | 4 | Two-electrode Voltage Clamp | Manual | Current Amplitude | Xenopus oocytes | N.A. | N.A. | Liquid | N.A. | N.A. | 8 s | Dekel, A., Yakir, E., & Bohbot ... | 10.1016/j.ibmb.2019.05.009 | Figure 2 |
| Aedes aegypti | Or4g | AHF20367.1 | - | MTQSIEFEQTFGFIAKVLQMIGYPSCLAPY ... | Aedes aegypti | Orco | NP_001345400.1 | - | MNVQPTKYHGLVLDLMPNIRLMQGFGHFLF ... | 6-Methyl-5-hepten-2-one | 110-93-0 | UHEPJGULSIKKTP-UHFFFAOYSA-N | 9862 | CC(=CCCC(=O)C)C | Monomolecular | Yes | Primary | N.A. | N.A. | N.A. | 13-17 | Single Sensillum Recording | Manual | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Gas Chromatography | N.A. | N.A. | 1 s | McBride, C. S., Baier, F., Omo ... | 10.1038/nature13964 | Figure 5 |