1
Unique InChIKey
2
Unique Receptor Sequence
1
Unique Co-Receptor Sequence
0
EC50 Parameter
1
Unique DOI
Results
Showing 1 to 2 of 2 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Drosophila melanogaster | Or94a | Q9VCS9 | - | MDKHKDRIESMRLILQVMQLFGLWPWSLKS ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Hexane | 110-54-3 | VLKZOEOYAKHREP-UHFFFAOYSA-N | 8058 | CCCCCC | Monomolecular | No | Primary | 8.8 Spikes/s | Norm. receptor | 0.01 V/V | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | N.A. | N.A. | N.A. | 0.5 s | Dweck, Hany K. M., Ebrahim, S ... | 10.1016/j.cub.2014.11.062 | Münch & Galizia 2016 Scientific Report |
| Drosophila melanogaster | Or94b | Q9VCS8 | - | MESTNRLSAIQTLLVIQRWIGLLKWENEGE ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Hexane | 110-54-3 | VLKZOEOYAKHREP-UHFFFAOYSA-N | 8058 | CCCCCC | Monomolecular | No | Primary | -1.6 Spikes/s | Norm. receptor | 0.01 V/V | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | N.A. | N.A. | N.A. | 0.5 s | Dweck, Hany K. M., Ebrahim, S ... | 10.1016/j.cub.2014.11.062 | Münch & Galizia 2016 Scientific Report |