1
Unique InChIKey
164
Unique Receptor Sequence
7
Unique Co-Receptor Sequence
5
EC50 Parameter
13
Unique DOI
Results
Showing 211 to 220 of 220 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Spodoptera littoralis | Or31 | CAB3514346.1 | - | MEDNVAYSTFEGFRPHFDALARVGYFKIVL ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | No | Primary | 8.6 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or32 | CAB3508034 | A100S | MVSSEDLFLNRAKFVMKYLGVWVLADNASY ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | No | Dose-Response | 0.75 Spikes/s | Raw | 0.1 µg | 4 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or32 | CAB3508034 | A100S | MVSSEDLFLNRAKFVMKYLGVWVLADNASY ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | Yes | Dose-Response | 4 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or32 | CAB3508034 | A100S | MVSSEDLFLNRAKFVMKYLGVWVLADNASY ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | Yes | Dose-Response | 19 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or32 | CAB3508034 | A100S | MVSSEDLFLNRAKFVMKYLGVWVLADNASY ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | Yes | Dose-Response | 46.667 Spikes/s | Raw | 100 µg | 15 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | Yes | Dose-Response | 37.071 Spikes/s | Raw | 100 µg | 14 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | No | Dose-Response | 2.8 Spikes/s | Raw | 0.1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | No | Dose-Response | 7.6 Spikes/s | Raw | 1 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or35 | CAB3509398 | D11E · N244D · D250_... | MWNKIRKFGLEYCDLPTMIWNVAVFLKVLT ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | Yes | Dose-Response | 23.2 Spikes/s | Raw | 10 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |
| Spodoptera littoralis | Or36 | CAB3509397 | Y110C · T136S | MLTFHEIIHEIRKFGLEYCDLPTMLENVSI ... | Drosophila melanogaster | Orco | Q9VNB5 | - | MTTSMQPSKYTGLVADLMPNIRAMKYSGLF ... | Indole | 120-72-9 | SIKJAQJRHWYJAI-UHFFFAOYSA-N | 798 | C1=CC=C2C(=C1)C=CN2 | Monomolecular | No | Primary | 12.8 Spikes/s | Raw | 100 µg | 5 | Single Sensillum Recording | tungsten electrode | Spiking Frequency | Drosophila | ab3A | Or22a-Gal4 | Airborne Paper | 0.6 L/min | 1.5 L/min | 500 ms | de Fouchier, A., Walker, W. B. ... | 10.1038/ncomms15709 | reanalysis of raw data |