3-Methyl-2-cyclopenten-1-one | M2iOR

New Database Available - Released on 02/10/2026.

|

|

About Us Contact Us How To Documentation

3-Methyl-2-cyclopenten-1-one

CID: 17691

InChIKey: CHCCBPDEADMNCI-UHFFFAOYSA-N

SMILES: CC1=CC(=O)CC1

Mixture: Monomolecular

1

Unique InChIKey

1

Unique Receptor Sequence

1

Unique Co-Receptor Sequence

1

EC50 Parameter

1

Unique DOI

Showing 1 to 2 of 2 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Bombyx mori	Or56	C4B7Y4	-	MKLLEKLEDPDRPLLGPNVKALKFWGLLLP ...	Bombyx mori	Orco	Q7YT34	-	MMTKVKTQGLVTDLMPCIRLLQAAGHFLFN ...	3-Methyl-2-cyclopenten-1-one 3-Methyl-2-cyclopentenone	2758-18-1	CHCCBPDEADMNCI-UHFFFAOYSA-N	17691	CC1=CC(=O)CC1	Monomolecular	No	Primary	0 nA	Raw	100 µM	4	Two-electrode Voltage Clamp	N.A.	Current Amplitude	Xenopus oocytes	N.A.	N.A.	Liquid	N.A.	N.A.	3 s	Tanaka, K., Uda, Y., Ono, Y., ...	10.1016/j.cub.2009.04.035	Figure 5. (D-E) Expression of BmorOR-2 and BmorOR-56 in the Larval Antenna, and Structure-Activity Relationship of BmorOR-56 in the Receptor Function and Behavioral Assays
Bombyx mori	Or56	C4B7Y4	-	MKLLEKLEDPDRPLLGPNVKALKFWGLLLP ...	Bombyx mori	Orco	Q7YT34	-	MMTKVKTQGLVTDLMPCIRLLQAAGHFLFN ...	3-Methyl-2-cyclopenten-1-one 3-Methyl-2-cyclopentenone	2758-18-1	CHCCBPDEADMNCI-UHFFFAOYSA-N	17691	CC1=CC(=O)CC1	Monomolecular	No	Dose-Response	N.A.	EC50	0.01-1,000 µM	4	Two-electrode Voltage Clamp	N.A.	Current Amplitude	Xenopus oocytes	N.A.	N.A.	Liquid	N.A.	N.A.	3 s	Tanaka, K., Uda, Y., Ono, Y., ...	10.1016/j.cub.2009.04.035	Figure 5. (F) Expression of BmorOR-2 and BmorOR-56 in the Larval Antenna, and Structure-Activity Relationship of BmorOR-56 in the Receptor Function and Behavioral Assays