New Database Available - Released on 11/08/2026.
626
Unique InChIKey
293
Unique Receptor Sequence
16
Unique Co-Receptor Sequence
452
EC50 Parameter
30
Unique DOI
Showing 121 to 150 of 30980 results
 
Species
Name
Mutated
Species
Name
Mutated
Name
Mixture
Responsive
Parameter
Value Nature
Nb. Measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Reference
Receptor Co-Receptor Molecule Response Bioassay Resources
Species
Name
Accession
Mutation
Sequence
Species
Name
Accession
Mutation
Sequence
Name
CAS
InChIKey
CID
SMILES
Mixture
Responsive
Parameter
Value
Value Nature
Concentration
Nb. measurements
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Stimulation Flux
Main Flux
Stimulation Duration
Reference
DOI
Reference Position
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 1-Octen-3-Ol 3391-86-4 VSMOENVRRABVKN-UHFFFAOYSA-N 18827 CCCCCC(C=C)O Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 1-Hexanol 111-27-3 ZSIAUFGUXNUGDI-UHFFFAOYSA-N 8103 CCCCCCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Ethanol 64-17-5 LFQSCWFLJHTTHZ-UHFFFAOYSA-N 702 CCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane 68108-90-7 XNNASGSBOJGKAZ-IUCAKERBSA-N 155085 C[C@H]1CCC[C@]2(O1)CCCO2 Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Phenylethanol 1960-12-08 WRMNZCZEMHIOCP-UHFFFAOYSA-N 6054 C1=CC=C(C=C1)CCO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Acetophenone 98-86-2 KWOLFJPFCHCOCG-UHFFFAOYSA-N 7410 CC(=O)C1=CC=CC=C1 Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Styrene 100-42-5 PPBRXRYQALVLMV-UHFFFAOYSA-N 7501 C=CC1=CC=CC=C1 Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 4-Methoxystyrene 637-69-4 UAJRSHJHFRVGMG-UHFFFAOYSA-N 12507 COC1=CC=C(C=C1)C=C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Estragole 140-67-0 ZFMSMUAANRJZFM-UHFFFAOYSA-N 8815 COC1=CC=C(C=C1)CC=C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 3,4-Dimethoxytoluene 494-99-5 GYPMBQZAVBFUIZ-UHFFFAOYSA-N 68126 CC1=CC(=C(C=C1)OC)OC Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Methyleugenol 93-15-2 ZYEMGPIYFIJGTP-UHFFFAOYSA-N 7127 COC1=C(C=C(C=C1)CC=C)OC Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or27 A0A8F3EVI2 - MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 4-Ethylguaiacol 2785-89-9 CHWNEIVBYREQRF-UHFFFAOYSA-N 62465 CCC1=CC(=C(C=C1)O)OC Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (Z)-2-Methyl-6-methylene-2,7-octadien-1-ol 17015-29-1 IEVYLQISZQFFGA-JXMROGBWSA-N 5319723 C/C(=C\CCC(=C)C=C)/CO Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-methylthioadenosine triphosphate tetrasodium 43170-89-4 XNOBOKJVOTYSJV-UHFFFAOYSA-N 1582 CSC1=NC(=C2C(=N1)N(C=N2)C3C(C(C(O3)COP(= ... Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 6,8-dioxabicyclo[3.2.1]octane, 1,5-dimethyl- 60478-96-8 AZWKCIZRVUVZPX-UHFFFAOYSA-N 34235 CC12CCCC(O1)(OC2)C Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Ipsdienol 35628-00-3 NHMKYUHMPXBMFI-SNVBAGLBSA-N 92301 CC(=C[C@H](CC(=C)C=C)O)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (4R)-2-methyl-6-methylideneocta-2,7-dien-4-ol 60894-97-5 NHMKYUHMPXBMFI-JTQLQIEISA-N 181296 CC(=C[C@@H](CC(=C)C=C)O)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... (-)-4-terpineol 20126-76-5 WRYLYDPHFGVWKC-JTQLQIEISA-N 5325830 CC1=CC[C@](CC1)(C(C)C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Camphor 76-22-2 DSSYKIVIOFKYAU-UHFFFAOYSA-N 2537 CC1(C2CCC1(C(=O)C2)C)C Sum of Isomers Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Pinocarvone, trans-(-)- 19890-00-7 TZDMGBLPGZXHJI-JGVFFNPUSA-N 12314319 CC1([C@H]2C[C@@H]1C(=C)C(=O)C2)C Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... trans-Pinocamphone (pinocamphone) N.A. MQPHVIPKLRXGDJ-BIIVOSGPSA-N 6430551 C[C@H]1[C@H]2C[C@H](C2(C)C)CC1=O Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Pinocamphone 547-60-4 MQPHVIPKLRXGDJ-PRJMDXOYSA-N 6427105 C[C@@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Isopinocamphone 14575-93-0 MQPHVIPKLRXGDJ-RNJXMRFFSA-N 84532 C[C@H]1[C@@H]2C[C@@H](C2(C)C)CC1=O Monomolecular Yes Dose-Response N.A. EC50 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Gamma-Terpinene 99-85-4 YKFLAYDHMOASIY-UHFFFAOYSA-N 7461 CC1=CCC(=CC1)C(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Verbenol, (S)-cis- 18881-04-04 WONIGEXYPVIKFS-YIZRAAEISA-N 87839 CC1=C[C@@H]([C@H]2C[C@@H]1C2(C)C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Bicyclo(3.1.1)hept-3-en-2-ol, 4,6,6-trimethyl-, (1R,2S,5R)-rel- 1820-09-03 WONIGEXYPVIKFS-VGMNWLOBSA-N 89664 CC1=C[C@@H]([C@@H]2C[C@H]1C2(C)C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Verbenol, (S)-trans- 19890-02-09 WONIGEXYPVIKFS-DJLDLDEBSA-N 88298 CC1=C[C@H]([C@H]2C[C@@H]1C2(C)C)O Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... Levoverbenone 1196-01-06 DCSCXTJOXBUFGB-JGVFFNPUSA-N 92874 CC1=CC(=O)[C@H]2C[C@@H]1C2(C)C Monomolecular No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-2,7-octadien-4-ol 14434-41-4 NHMKYUHMPXBMFI-UHFFFAOYSA-N 85734 CC(=CC(CC(=C)C=C)O)C Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Ips typographus Or29 A0A8F3IVT0 K111E MAAYPQCKNLRVAIIYSSIIGVFPWQFMFQ ... Ips typographus Orco ref|XP_081832551.1| - MMNKFKVAGLVADLMPNIRLIQASGHFMFN ... 2-Methyl-6-methylene-7-octen-4-ol 14314-21-7 RHAXCOKCIAVHPB-UHFFFAOYSA-N 85712 CC(C)CC(CC(=C)C=C)O Sum of Isomers No Primary N.A. Norm. other 100 µM 4 Two-electrode Voltage Clamp manual two-electrode voltage clamp Current Amplitude Xenopus Ooctye N.A. pT7T Liquid N.A. N.A. N.A. Hou, X.-Q., Yuvaraj, J. K., Ro ... 10.1093/molbev/msab218 N.A.
Filters
Receptor
Species
Name
Mutated
Co-Receptor
Species
Name
Mutated
Molecule
Name
Mixture
Response
Responsive
Parameter
Value Nature
Nb. Measurements
BioAssay
Experimental Technique
Recording System
Type
Expression System
Expression Cell Type
Expression Driver
Odor Delivery System
Resources
Reference