626
Unique InChIKey
293
Unique Receptor Sequence
16
Unique Co-Receptor Sequence
452
EC50 Parameter
30
Unique DOI
Results
Showing 30961 to 30980 of 30980 results
| Receptor | Co-Receptor | Molecule | Response | Bioassay | Resources | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 25.299 % | Norm. receptor | 3.750e-5 M | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | -0.062 % | Norm. receptor | 4.690e-6 M | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | -0.583 % | Norm. receptor | 5.900e-7 M | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 0.111 % | Norm. receptor | 7.320e-8 M | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 30.358 % | Norm. receptor | 7.500e-5 M | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 2.788 % | Norm. receptor | 9.380e-6 M | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | Yes | Dose-Response | 21.08 µM | EC50 | N.A. | 12 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 20.399 % | Norm. receptor | 1.500e-4 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 4.404e-4 % | Norm. receptor | 1.170e-6 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 0.057 % | Norm. receptor | 1.460e-7 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 8.178 % | Norm. receptor | 1.880e-5 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | -0.499 % | Norm. receptor | 2.340e-6 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 0.939 % | Norm. receptor | 2.900e-7 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 17.432 % | Norm. receptor | 3.750e-5 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 0.027 % | Norm. receptor | 4.690e-6 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 0.251 % | Norm. receptor | 5.900e-7 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | -1.069 % | Norm. receptor | 7.320e-8 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 21.56 % | Norm. receptor | 7.500e-5 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | N.A. | Dose-Response | 2.093 % | Norm. receptor | 9.380e-6 M | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |
| Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Ips typographus | Orco | ref|XP_081832551.1| | M1L | MEQKLISEEDLMNKFKVAGLVADLMPNIRL ... | Vuaa1 | 525582-84-7 | UWCCKVJVOHTHAF-UHFFFAOYSA-N | 1319135 | CCC1=CC=C(C=C1)NC(=O)CSC2=NN=C(N2CC)C3=C ... | Monomolecular | Yes | Dose-Response | 22.87 µM | EC50 | N.A. | 10 | Calcium Imaging | CLARIOstar Omega plate reader (BMG Labtech) | ∆ Fluorescence | Hek | HEK293 | pcDNATM4/TO | Liquid | N.A. | N.A. | N.A. | Roberts, R. E., Yuvaraj, J. K. ... | 10.3389/fncel.2021.744401 | N.A. |