M2OR : Database of Olfactory Receptors-Molecule Measurments

626

Unique InChIKey

293

Unique Receptor Sequence

Unique Co-Receptor Sequence

452

EC50 Parameter

Unique DOI

Showing 61 to 90 of 30980 results

Receptor					Co-Receptor					Molecule						Response						Bioassay										Resources
Species	Name	Accession	Mutation	Sequence	Species	Name	Accession	Mutation	Sequence	Name	CAS	InChIKey	CID	SMILES	Mixture	Responsive	Parameter	Value	Value Nature	Concentration	Nb. measurements	Experimental Technique	Recording System	Type	Expression System	Expression Cell Type	Expression Driver	Odor Delivery System	Stimulation Flux	Main Flux	Stimulation Duration	Reference	DOI	Reference Position
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-2,7-octadien-4-ol	14434-41-4	NHMKYUHMPXBMFI-UHFFFAOYSA-N	85734	CC(=CC(CC(=C)C=C)O)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-6-methylene-7-octen-4-ol	14314-21-7	RHAXCOKCIAVHPB-UHFFFAOYSA-N	85712	CC(C)CC(CC(=C)C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	3,7-Octadien-2-ol, 2-methyl-6-methylene-, (E)-	6994-89-4	NOEQSPUVXRMJBW-SOFGYWHQSA-N	5363351	CC(C)(/C=C/CC(=C)C=C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	4-Thujanol	17699-16-0	KXSDPILWMGFJMM-AEJSXWLSSA-N	6326181	CC(C)[C@@]12CC[C@@]([C@@H]1C2)(C)O	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Grandisol	26532-22-9	SJKPJXGGNKMRPD-VHSXEESVSA-N	169202	CC(=C)[C@@H]1CC[C@]1(C)CCO	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	6,10-Dimethylundeca-5,9-Dien-2-One	689-67-8	HNZUNIKWNYHEJJ-UHFFFAOYSA-N	19633	CC(=CCCC(=CCCC(=O)C)C)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(1R,2R,5S)-2,6,6-trimethylbicyclo[3.1.1]heptan-3-one	473-62-1	MQPHVIPKLRXGDJ-GJMOJQLCSA-N	10329459	C[C@@H]1[C@H]2C[C@H](C2(C)C)CC1=O	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	1,8-Cineole	470-82-6	WEEGYLXZBRQIMU-UHFFFAOYSA-N	2758	CC1(C2CCC(O1)(CC2)C)C	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Isophorone	78-59-1	HJOVHMDZYOCNQW-UHFFFAOYSA-N	6544	CC1=CC(=O)CC(C1)(C)C	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Lanierone	28750-52-9	GKOBUKITZSFCJC-UHFFFAOYSA-N	642486	CC1=CC(C=C(C1=O)O)(C)C	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Methyl-3-buten-2-ol	115-18-4	HNVRRHSXBLFLIG-UHFFFAOYSA-N	8257	CC(C)(C=C)O	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	alpha-Pinene, (+)-	7785-70-8	GRWFGVWFFZKLTI-RKDXNWHRSA-N	82227	CC1=CC[C@@H]2C[C@H]1C2(C)C	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Myrcene	123-35-3	UAHWPYUMFXYFJY-UHFFFAOYSA-N	31253	CC(=CCCC(=C)C=C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	P-Cymene	99-87-6	HFPZCAJZSCWRBC-UHFFFAOYSA-N	7463	CC1=CC=C(C=C1)C(C)C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(+)-3-Carene	498-15-7	BQOFWKZOCNGFEC-BDAKNGLRSA-N	443156	CC1=CC[C@@H]2[C@H](C1)C2(C)C	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	3-Octanol	589-98-0	NMRPBPVERJPACX-UHFFFAOYSA-N	11527	CCCCCC(CC)O	Sum of Isomers	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	1-Octen-3-Ol	3391-86-4	VSMOENVRRABVKN-UHFFFAOYSA-N	18827	CCCCCC(C=C)O	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	1-Hexanol	111-27-3	ZSIAUFGUXNUGDI-UHFFFAOYSA-N	8103	CCCCCCO	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Ethanol	64-17-5	LFQSCWFLJHTTHZ-UHFFFAOYSA-N	702	CCO	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(5S,7S)-7-Methyl-1,6-dioxaspiro[4.5]decane	68108-90-7	XNNASGSBOJGKAZ-IUCAKERBSA-N	155085	C[C@H]1CCC[C@]2(O1)CCCO2	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-Phenylethanol	1960-12-08	WRMNZCZEMHIOCP-UHFFFAOYSA-N	6054	C1=CC=C(C=C1)CCO	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Acetophenone	98-86-2	KWOLFJPFCHCOCG-UHFFFAOYSA-N	7410	CC(=O)C1=CC=CC=C1	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Styrene	100-42-5	PPBRXRYQALVLMV-UHFFFAOYSA-N	7501	C=CC1=CC=CC=C1	Monomolecular	Yes	Dose-Response	N.A.	EC50	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	4-Methoxystyrene	637-69-4	UAJRSHJHFRVGMG-UHFFFAOYSA-N	12507	COC1=CC=C(C=C1)C=C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Estragole	140-67-0	ZFMSMUAANRJZFM-UHFFFAOYSA-N	8815	COC1=CC=C(C=C1)CC=C	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	3,4-Dimethoxytoluene	494-99-5	GYPMBQZAVBFUIZ-UHFFFAOYSA-N	68126	CC1=CC(=C(C=C1)OC)OC	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	Methyleugenol	93-15-2	ZYEMGPIYFIJGTP-UHFFFAOYSA-N	7127	COC1=C(C=C(C=C1)CC=C)OC	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or25	A0A8F3ERC7	-	MKIYPDTKFFDVTAKFGAIVGLYPWQFMFP ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	4-Ethylguaiacol	2785-89-9	CHWNEIVBYREQRF-UHFFFAOYSA-N	62465	CCC1=CC(=C(C=C1)O)OC	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or27	A0A8F3EVI2	-	MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	(Z)-2-Methyl-6-methylene-2,7-octadien-1-ol	17015-29-1	IEVYLQISZQFFGA-JXMROGBWSA-N	5319723	C/C(=C\CCC(=C)C=C)/CO	Monomolecular	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.
Ips typographus	Or27	A0A8F3EVI2	-	MRVYPDIENFKITAIYSSTIGLFPWKFMFQ ...	Ips typographus	Orco	ref\|XP_081832551.1\|	-	MMNKFKVAGLVADLMPNIRLIQASGHFMFN ...	2-methylthioadenosine triphosphate tetrasodium	43170-89-4	XNOBOKJVOTYSJV-UHFFFAOYSA-N	1582	CSC1=NC(=C2C(=N1)N(C=N2)C3C(C(C(O3)COP(= ...	Sum of Isomers	No	Primary	N.A.	Norm. other	100 µM	4	Two-electrode Voltage Clamp	manual two-electrode voltage clamp	Current Amplitude	Xenopus Ooctye	N.A.	pT7T	Liquid	N.A.	N.A.	N.A.	Hou, X.-Q., Yuvaraj, J. K., Ro ...	10.1093/molbev/msab218	N.A.

Showing 61 to 90 of 30980 results

‹
1
2
3
4
5
6
7
8
9
10
1032
1033
›